| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human S100A7 is produced by our E, coli expression system and the target gene encoding Met1-Gln101 is expressed |
| Molecular Weight: |
11, 5 kD |
| UniProt number: |
P31151 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, -20°, Aliquots of reconstituted samples are stable at <, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 4 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
S100A7 |
| Short name: |
Recombinant S100A7 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens S100 calcium binding protein A7, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
PSOR1 and S100A7c, RAGE receptor binding, S100A7 and IDBG-102676 and ENSG00000143556 and 6278, nuclei, this GO :0000302 and response to reactive oxygen species and biological process this GO :0001525 and angiogenesis and biological process this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005829 and cytosol and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0008270 and zinc ion binding and molecular function this GO :0008544 and epidermis development and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0030216 and keratinocyte differentiation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0045087 and innate immune response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0051238 and sequestering of metal ion and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071624 and positive regulation of granulocyte chemotaxis and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process, this GO :0005509 : calcium ion binding, this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0050786 : RAGE receptor binding, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A7 |
| Identity: |
10497 |
| Gene: |
S100A7 |
More about : S100A7 |
| Long gene name: |
S100 calcium binding protein A7 |
| Synonyms gene: |
PSOR1 |
| Synonyms gene name: |
S100 calcium-binding protein A7 (psoriasin 1) S100 calcium binding protein A7 (psoriasin 1) |
| Synonyms: |
S100A7c |
| Locus: |
1q21, 3 |
| Discovery year: |
1992-10-08 |
| GenBank acession: |
BC034687 |
| Entrez gene record: |
6278 |
| Pubmed identfication: |
1940442 |
| RefSeq identity: |
NM_002963 |
| Classification: |
S100 calcium binding proteins EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000013123 |