Recombinant S. cerevisiae TIM16

Contact us
Catalog number: CR27
Price: 608 €
Supplier: Natrols and viral diagnostic antigens
Product name: Recombinant S. cerevisiae TIM16
Quantity: 1 mL
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: cerevisiae, S
Source: proteins, Recombinants or rec
Description: cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E, Recombinant S, coli expression system and the target gene encoding Thr54-Ala119 is expressed
Molecular Weight: 7, 9 kD
UniProt number: P42949
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM Tris, 300 mM sodium chloride, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: cerevisiae TIM16, S
Short name: cerevisiae TIM16, Recombinant S
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: cerevisiae TIM16, recombinant S
Alternative technique: rec
Identity: 29679
Gene: PAM16 | More about : PAM16
Long gene name: presequence translocase associated motor 16 homolog
Synonyms gene name: cerevisiae) , presequence translocase-associated motor 16 homolog (S
Synonyms: Magmas Tim16 TIMM16
Synonyms name: mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction
Locus: 16p13, 3
Discovery year: 2010-09-01
GenBank acession: AK026514
Entrez gene record: 51025
Pubmed identfication: 10810093 11750097
RefSeq identity: NM_016069
Havana BLAST/BLAT: OTTHUMG00000129466

Related Products :

CR27 Recombinant S. cerevisiae TIM16 10 µg 202 € novo human
GENTAUR-58bd5dac22854 Emericella nidulans Mitochondrial import inner membrane translocase subunit tim16 (pam16) 100ug 1459 € MBS Recombinant Proteins human
GENTAUR-58bd5dac73566 Emericella nidulans Mitochondrial import inner membrane translocase subunit tim16 (pam16) 1000ug 1459 € MBS Recombinant Proteins human
GENTAUR-58bd5dacb891f Emericella nidulans Mitochondrial import inner membrane translocase subunit tim16 (pam16) 100ug 1962 € MBS Recombinant Proteins human
GENTAUR-58bd5dad0b6cd Emericella nidulans Mitochondrial import inner membrane translocase subunit tim16 (pam16) 1000ug 1962 € MBS Recombinant Proteins human
GENTAUR-58bd774f263fc Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 100ug 1464 € MBS Recombinant Proteins human
GENTAUR-58bd774f72488 Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 1000ug 1464 € MBS Recombinant Proteins human
GENTAUR-58bd774fbc6d2 Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 100ug 1967 € MBS Recombinant Proteins human
GENTAUR-58bd775025d75 Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 1000ug 1967 € MBS Recombinant Proteins human
GENTAUR-58bd584cb56d1 Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bd584d1405e Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bd584d53d12 Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bd584d99eb2 Human Mitochondrial import inner membrane translocase subunit TIM16 (PAM16) 1000ug 1934 € MBS Recombinant Proteins human
MBS619546 SUPT6H (Suppressor of Ty (S. cerevisiae) 6 Homolog, Suppressor of Ty 6 Homolog (S. cerevisiae), SPT6H, Emb-5, hSPT6, KIAA0162, MGC87943, Tat-cotransactivator 2 Protein, Tat-CT2 Protein, Transcription Elongation Factor SPT6) 100ul 785 € MBS Polyclonals_1 human
abx260373 Anti-Saccharomyces cerevisiae Heat Shock Protein 104 Protein (Recombinant) 1 mg 1920 € abbex human
801697 Blastomyces dermatitidis-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
0801677DNA-1UG Coccidioides immitis-S. cerevisiae Recombinant, genomic crontrol DNA for LOD limit of detection determinantion 1 µg 608 € Natrols and viral diagnostic antigens human
801677 Coccidioides immitis-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
0801700DNA-1UG Cryptosporidium parvum-S. cerevisiae Recombinant, genomic crontrol DNA for LOD limit of detection determinantion 1 µg 608 € Natrols and viral diagnostic antigens human
801700 Cryptosporidium parvum-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
801787 Escherichia coli O157-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
801788 Giardia lamblia-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
801676 Histoplasma capsulatum-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
GWB-P0163G Hsp104(amino acids 1-908) Saccharomyces cerevisiae, Recombinant Protein bulk Ask price € genways bulk human
0801698DNA-1UG Pneumocystis jiroveci-S. cerevisiae Recombinant, genomic crontrol DNA for LOD limit of detection determinantion 1 µg 608 € Natrols and viral diagnostic antigens human
801698 Pneumocystis jiroveci-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
CR26 Recombinant S. cerevisiae TIM14 10 µg 202 € novo human
RP-630 Recombinant Saccharomyces cerevisiae Heat Shock Protein 104 (hsp104) 10 μg 260 € adi human
801792 Shiga Toxin 1-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human
801793 Shiga Toxin 2-S. cerevisiae Recombinant, titered control for LOD limit of detection determination in diagnostic kits 1 mL 608 € Natrols and viral diagnostic antigens human