| Reacts with: |
cerevisiae, S |
| Source: |
proteins, Recombinants or rec |
| Description: |
cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E, Recombinant S, coli expression system and the target gene encoding Thr54-Ala119 is expressed |
| Molecular Weight: |
7, 9 kD |
| UniProt number: |
P42949 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM Tris, 300 mM sodium chloride, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
cerevisiae TIM16, S |
| Short name: |
cerevisiae TIM16, Recombinant S |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name: |
cerevisiae TIM16, recombinant S |
| Alternative technique: |
rec |
| Identity: |
29679 |
| Gene: |
PAM16 |
More about : PAM16 |
| Long gene name: |
presequence translocase associated motor 16 homolog |
| Synonyms gene name: |
cerevisiae) , presequence translocase-associated motor 16 homolog (S |
| Synonyms: |
Magmas Tim16 TIMM16 |
| Synonyms name: |
mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction |
| Locus: |
16p13, 3 |
| Discovery year: |
2010-09-01 |
| GenBank acession: |
AK026514 |
| Entrez gene record: |
51025 |
| Pubmed identfication: |
10810093 11750097 |
| RefSeq identity: |
NM_016069 |
| Havana BLAST/BLAT: |
OTTHUMG00000129466 |