Recombinant Human Cystatin C, CST3 (E.coli)

Contact us
Catalog number: CR17
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Cystatin C, CST3 (E.coli)
Quantity: inquire
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cystatin C is produced by our E, coli expression system and the target gene encoding Gly26-Ala146 is expressed
Molecular Weight: 13, 4 kD
UniProt number: P01034
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM HEPES, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CST3 (E, Cystatin C, coli)
Short name: CST3 (E, Recombinant Cystatin C, coli)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: Humans, Human
Alternative name: CST3 (Escherichia Coli), sapiens Cystatin C, recombinant H
Alternative technique: rec
Identity: 2475
Gene: CST3 | More about : CST3
Long gene name: cystatin C
Synonyms gene name: cystatin C (amyloid angiopathy and cerebral hemorrhage)
Locus: 20p11, 21
Discovery year: 1990-02-06
Entrez gene record: 1471
Pubmed identfication: 8486384
RefSeq identity: NM_000099
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000032080

Related Products :

CR17 Recombinant Human Cystatin C, CST3 (E.coli) 1 mg 2486 € novo human
CS25 Recombinant Human Cystatin C, CST3 (Human Cells) 500 µg 1755 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
RP-0524H Recombinant Human Cystatin C / CST3 Protein (His Tag) 10μg 624 € adv human
RP-1233M Recombinant Mouse Cystatin C / CST3 Protein (His Tag) 10μg 624 € adv mouse
GWB-ATG168 CST3, 27-146aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
abx573769 Anti-Human Cystatin 3 (CST3) ELISA Kit 96 tests 586 € abbex human
MBS243435 Goat Polyclonal to Human CST3 / Cystatin C Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CST3-Hu Human Cystatin 3 CST3 ELISA Kit 96T 672 € DL elisas human
GENTAUR-58bde83ab135a Mouse Monoclonal (IgG2b) to Human CST3 / Cystatin C Antibody 50ug 597 € MBS mono human
GENTAUR-58bdc2390e52e Anti- Cystatin 3 (CST3) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc2f06dbae Anti- Cystatin 3 (CST3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc2f241646 Anti- Cystatin 3 (CST3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc382b14f1 Anti- Cystatin 3 (CST3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc5be56021 Anti- Cystatin 3 (CST3) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdca7fd77b5 Anti- Cystatin 3 (CST3) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca8055155 Anti- Cystatin 3 (CST3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcaf1c8adc Anti- Cystatin 3 (CST3) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcaf24834c Anti- Cystatin 3 (CST3) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdcb1a1ddd6 Anti- Cystatin 3 (CST3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcb1a95826 Anti- Cystatin 3 (CST3) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb2387287 Anti- Cystatin 3 (CST3) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdd4c33c510 Anti- Cystatin 3 (CST3) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd5b4868f8 Anti- Cystatin 3 (CST3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd656d5a7b Anti- Cystatin 3 (CST3) Antibody 100ug 652 € MBS Polyclonals human
GENTAUR-58bdd98f58c7e Anti- Cystatin 3 (CST3) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58be61d21de22 Anti-Cystatin C/CST3 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx570080 Anti-Mouse Cystatin 3 (CST3) ELISA Kit 96 tests 746 € abbex mouse
abx570341 Anti-Pig Cystatin 3 (CST3) ELISA Kit inquire 50 € abbex pig