| Catalog number: | CR03 |
|---|---|
| Price: | 350 € |
| Supplier: | Bioss Primary Conjugated Antibodies |
| Product name: | Recombinant Human Osteocrin (N-6His) |
| Quantity: | 0.1ml |
| Other quantities: | 1 mg 2486€ 50 µg 496€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: | 14 kD |
| UniProt number: | P61366 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | Osteocrin (N-6His) |
| Short name: | Recombinant Osteocrin (N-6His) |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | sapiens Osteocrin (N-6His), recombinant H |
| Alternative technique: | rec |
| CR03 | Recombinant Human Osteocrin (N-6His) | 1 mg | 2486 € | novo | human |
| RP-868 | Recombinant (E.Coli, His-tag) Human Osteocrin | 10 μg | 333 € | adi | human |
| abx167301 | Anti-Osteocrin Protein (Recombinant) | 100 μg | 847 € | abbex | human |
| abx262154 | Anti-Osteocrin Protein (Recombinant) | 1 mg | 5531 € | abbex | human |
| abx190185 | Anti-Human Osteocrin CLIA Kit | 96 tests | 1079 € | abbex | human |
| abx152601 | Anti-Human Osteocrin ELISA Kit | inquire | 50 € | abbex | human |
| abx571227 | Anti-Human Osteocrin (OSTN) ELISA Kit | inquire | 50 € | abbex | human |
| AE29084HU-48 | ELISA test for Human Osteocrin (OSTN) | 1x plate of 48 wells | 402 € | abebio | human |
| AE29084HU | Human Osteocrin (OSTN) ELISA Kit | 48 wells plate | 515 € | ab-elisa elisas | human |
| AE29084HU-96 | Human Osteocrin (OSTN) ELISA Kit | 1x plate of 96 wells | 671 € | abebio | human |
| DL-OSTN-Hu | Human Osteocrin OSTN ELISA Kit | 96T | 904 € | DL elisas | human |
| GWB-393968 | Osteocrin Human | bulk | Ask price € | genways bulk | human |
| GENTAUR-58be304122968 | Anti- Osteocrin Antibody | 0.1 ml | 978 € | MBS Polyclonals | human |
| GENTAUR-58be308bbf70e | Anti- Osteocrin Antibody | 0.2 mg | 906 € | MBS Polyclonals | human |
| GENTAUR-58be30b88f643 | Anti- Osteocrin Antibody | 0.1 ml | 978 € | MBS Polyclonals | human |
| abx129379 | Anti-Osteocrin Antibody | 50 μg | 412 € | abbex | human |
| AR09945PU-N | anti-Osteocrin / OSTN (28-133, His-tag) Antibody | 50 Вµg | 1138 € | acr | human |
| AR09945PU-S | anti-Osteocrin / OSTN (28-133, His-tag) Antibody | 10 Вµg | 485 € | acr | human |
| GENTAUR-58be676ab69e0 | Anti-Osteocrin (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx155932 | Anti-Rat Osteocrin ELISA Kit | 96 tests | 992 € | abbex | rat |
| abx571228 | Anti-Rat Osteocrin (OSTN) ELISA Kit | inquire | 50 € | abbex | rat |
| AE29082RA-48 | ELISA test for Rat Osteocrin (Ostn) | 1x plate of 48 wells | 402 € | abebio | rat |
| bs-9566R-A350 | Osteocrin Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-9566R-A488 | Osteocrin Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-9566R-A555 | Osteocrin Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-9566R-A594 | Osteocrin Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-9566R-A647 | Osteocrin Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-9566R-Biotin | Osteocrin Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-9566R | Osteocrin Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-9566R-Cy3 | Osteocrin Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |