Recombinant Human Osteocrin (N-6His)

Contact us
Catalog number: CR03
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Osteocrin (N-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Osteocrin is produced by our expression system and the target gene encoding Val28-Gly133 is expressed with a 6His tag at the N-terminus
Molecular Weight: 14 kD
UniProt number: P61366
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Osteocrin (N-6His)
Short name: Recombinant Osteocrin (N-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Osteocrin (N-6His), recombinant H
Alternative technique: rec

Related Products :

CR03 Recombinant Human Osteocrin (N-6His) 1 mg 2486 € novo human
RP-868 Recombinant (E.Coli, His-tag) Human Osteocrin 10 μg 333 € adi human
abx167301 Anti-Osteocrin Protein (Recombinant) 100 μg 847 € abbex human
abx262154 Anti-Osteocrin Protein (Recombinant) 1 mg 5531 € abbex human
abx190185 Anti-Human Osteocrin CLIA Kit 96 tests 1079 € abbex human
abx152601 Anti-Human Osteocrin ELISA Kit inquire 50 € abbex human
abx571227 Anti-Human Osteocrin (OSTN) ELISA Kit inquire 50 € abbex human
AE29084HU-48 ELISA test for Human Osteocrin (OSTN) 1x plate of 48 wells 402 € abebio human
AE29084HU Human Osteocrin (OSTN) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE29084HU-96 Human Osteocrin (OSTN) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-OSTN-Hu Human Osteocrin OSTN ELISA Kit 96T 904 € DL elisas human
GWB-393968 Osteocrin Human bulk Ask price € genways bulk human
GENTAUR-58be304122968 Anti- Osteocrin Antibody 0.1 ml 978 € MBS Polyclonals human
GENTAUR-58be308bbf70e Anti- Osteocrin Antibody 0.2 mg 906 € MBS Polyclonals human
GENTAUR-58be30b88f643 Anti- Osteocrin Antibody 0.1 ml 978 € MBS Polyclonals human
abx129379 Anti-Osteocrin Antibody 50 μg 412 € abbex human
AR09945PU-N anti-Osteocrin / OSTN (28-133, His-tag) Antibody 50 Вµg 1138 € acr human
AR09945PU-S anti-Osteocrin / OSTN (28-133, His-tag) Antibody 10 Вµg 485 € acr human
GENTAUR-58be676ab69e0 Anti-Osteocrin (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx155932 Anti-Rat Osteocrin ELISA Kit 96 tests 992 € abbex rat
abx571228 Anti-Rat Osteocrin (OSTN) ELISA Kit inquire 50 € abbex rat
AE29082RA-48 ELISA test for Rat Osteocrin (Ostn) 1x plate of 48 wells 402 € abebio rat
bs-9566R-A350 Osteocrin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9566R-A488 Osteocrin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9566R-A555 Osteocrin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9566R-A594 Osteocrin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9566R-A647 Osteocrin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9566R-Biotin Osteocrin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9566R Osteocrin Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-9566R-Cy3 Osteocrin Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human