Recombinant E. coli RNA Pyrophosphohydrolase, rppH

Contact us
Catalog number: CM26
Price: 2283 €
Supplier: novo
Product name: Recombinant E. coli RNA Pyrophosphohydrolase, rppH
Quantity: 1 mg
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: E, coli
Source: proteins, Recombinants or rec
Description: Recombinant E, coli RNA pyrophosphohydrolase is produced by our E, coli expression system and the target gene encoding Met1-Gly176 is expressed
Molecular Weight: 20, 8 kD
UniProt number: P0A776
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% glycerol, 500 mM sodium chloride, pH8, 2 um filtered solution of 50 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: rppH, RNA Pyrophosphohydrolase
Short name: coli RNA Pyrophosphohydrolase, rppH, Recombinant E
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, coli, coli, E
Alternative name: coli RNA Pyrophosphohydrolase, rppH, recombinant E
Alternative technique: rec

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/