| Catalog number: | CM26 |
|---|---|
| Price: | 1564 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant E. coli RNA Pyrophosphohydrolase, rppH |
| Quantity: | 100ug |
| Other quantities: | 1 mg 2283€ 10 µg 156€ 50 µg 369€ |
| Related search: |
| Reacts with: | E, coli |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant E, coli RNA pyrophosphohydrolase is produced by our E, coli expression system and the target gene encoding Met1-Gly176 is expressed |
| Molecular Weight: | 20, 8 kD |
| UniProt number: | P0A776 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 10% glycerol, 500 mM sodium chloride, pH8, 2 um filtered solution of 50 mM Tris, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Group: | recombinants |
| Gene target: | rppH, RNA Pyrophosphohydrolase |
| Short name: | coli RNA Pyrophosphohydrolase, rppH, Recombinant E |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: | Escherichia coli |
| Species: | E, coli, coli, E |
| Alternative name: | coli RNA Pyrophosphohydrolase, rppH, recombinant E |
| Alternative technique: | rec |
| CM26 | Recombinant E. coli RNA Pyrophosphohydrolase, rppH | 500 µg | 1613 € | novo | e-coli |
| GENTAUR-58b9df36eedb4 | Escherichia coli O127:H6 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9df377b4fc | Escherichia coli O127:H6 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9df38312e8 | Escherichia coli O127:H6 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9df38d6f71 | Escherichia coli O127:H6 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9bd0ce1c1c | Escherichia coli O139:H28 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9bd0d43827 | Escherichia coli O139:H28 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9bd0db53c4 | Escherichia coli O139:H28 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9bd0e1e5ef | Escherichia coli O139:H28 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c855ba6aa | Escherichia coli O157:H7 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c85633093 | Escherichia coli O157:H7 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c8570550b | Escherichia coli O157:H7 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9c85774972 | Escherichia coli O157:H7 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc74044c119 | Escherichia coli O45:K1 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc74048fab5 | Escherichia coli O45:K1 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc7404d13d4 | Escherichia coli O45:K1 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc74050d9a2 | Escherichia coli O45:K1 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85e4d6f43e | Escherichia coli O8 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85e4de3097 | Escherichia coli O8 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85e4e22c7e | Escherichia coli O8 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b85e4e7edc1 | Escherichia coli O8 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8f22f43bbe | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8f22f79ee9 | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8f22fdcf9d | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8f230479fb | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9ee480b23c | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9ee4877b9a | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 1000ug | 1564 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9ee48c6514 | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 100ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58b9ee49332db | Escherichia coli O81 RNA pyrophosphohydrolase (rppH) | 1000ug | 2067 € | MBS Recombinant Proteins | human |
| GENTAUR-58bc180fe9d41 | Escherichia coli O9:H4 RNA pyrophosphohydrolase (rppH) | 100ug | 1564 € | MBS Recombinant Proteins | human |