Recombinant E. coli RNA Pyrophosphohydrolase, rppH

Catalog number:	CM26 Buy Now
Price:	1564 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant E. coli RNA Pyrophosphohydrolase, rppH
Quantity:	100ug
Other quantities:	1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:	coli recombinant pyrophosphohydrolase rpph alternative uniprot

More details Need more?:

Reacts with:	E, coli
Source:	proteins, Recombinants or rec
Description:	Recombinant E, coli RNA pyrophosphohydrolase is produced by our E, coli expression system and the target gene encoding Met1-Gly176 is expressed
Molecular Weight:	20, 8 kD
UniProt number:	P0A776
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	10% glycerol, 500 mM sodium chloride, pH8, 2 um filtered solution of 50 mM Tris, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Group:	recombinants
Gene target:	rppH, RNA Pyrophosphohydrolase
Short name:	coli RNA Pyrophosphohydrolase, rppH, Recombinant E
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host:	Escherichia coli
Species:	E, coli, coli, E
Alternative name:	coli RNA Pyrophosphohydrolase, rppH, recombinant E
Alternative technique:	rec

• #coli
• #recombinant
• #pyrophosphohydrolase
• #rpph
• #alternative
• #uniprot