Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli)

Contact us
Catalog number: CH52
Price: 156 €
Supplier: novo
Product name: Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli)
Quantity: 50 µg
Other quantities: 1 mg 1115€ 10 µg 100€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein A-I is produced by our E, coli expression system and the target gene encoding Arg19-Gln267 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 30
UniProt number: P02647
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoA1 (C-6His, Apolipoprotein A1
Short name: ApoA1 (C-6His, E, coli), Recombinant Apolipoprotein A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: E, apolipoprotein A-I (C-6His, coli), sapiens Apolipoprotein A1, recombinant H
Alternative technique: rec

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/