Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli)

Contact us
Catalog number: CH52
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli)
Quantity: 100ug
Other quantities: 1 mg 1115€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein A-I is produced by our E, coli expression system and the target gene encoding Arg19-Gln267 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 30
UniProt number: P02647
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoA1 (C-6His, Apolipoprotein A1
Short name: ApoA1 (C-6His, E, coli), Recombinant Apolipoprotein A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: E, apolipoprotein A-I (C-6His, coli), sapiens Apolipoprotein A1, recombinant H
Alternative technique: rec

Related Products :

CH52 Recombinant Human Apolipoprotein A1, ApoA1 (C-6His, E. coli) 1 mg 1115 € novo e-coli
C511 Recombinant Human Apolipoprotein A1, ApoA1 (C-6His) 50 µg 369 € novo human
CK19 Recombinant Human Apolipoprotein A-I, APOA1 500 µg 1186 € novo human
abx575180 Anti-Human Apolipoprotein A1 (APOA1) ELISA Kit inquire 50 € abbex human
GWB-71197B Apolipoprotein A-I (APOA1) Goat antibody to or anti-Human Polyclonal antibody 1 tube 602 € genways human
GWB-23F479 Apolipoprotein A-I (APOA1) Rabbit antibody to or anti-Human Polyclonal (aa188-199) antibody 1 x 1 vial 602 € genways human
MBS242063 Goat Polyclonal (IgG) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS243069 Goat Polyclonal (IgG) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS Polyclonals_1 human
DL-APOA1-Hu Human Apolipoprotein A1 APOA1 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bde61d4ab2a Mouse Monoclonal [clone 057-10029] (IgG2a,k) to Human APOA1 / Apolipoprotein A 1 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde863cec60 Mouse Monoclonal [clone 464CT10.4.4] (IgG1) to Human APOA1 / Apolipoprotein A 1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde86774d8c Mouse Monoclonal [clone AT1E12] (IgG1,k) to Human APOA1 / Apolipoprotein A 1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58b9d701f3733 Anas platyrhynchos Apolipoprotein A-I (APOA1) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9d7026ec73 Anas platyrhynchos Apolipoprotein A-I (APOA1) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9d702d3a27 Anas platyrhynchos Apolipoprotein A-I (APOA1) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9d70354f47 Anas platyrhynchos Apolipoprotein A-I (APOA1) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bdc15103548 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc15167631 Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 404 € MBS Polyclonals human
GENTAUR-58bdc1ebb0642 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc1f1b665f Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc1f21550f Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc5370e87f Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 619 € MBS Polyclonals human
GENTAUR-58bdc72c376da Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 420 € MBS Polyclonals human
GENTAUR-58bdc72ca91d0 Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 337 € MBS Polyclonals human
GENTAUR-58bdc7871797e Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdc9729befb Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcc0d6135e Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bdcc0dc8bbb Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcc1f2700d Anti- Apolipoprotein A1 (APOA1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcc1f94bd2 Anti- Apolipoprotein A1 (APOA1) Antibody 100ug 520 € MBS Polyclonals human