Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, E. coli)

Contact us
Catalog number: CH31
Price: 2283 €
Supplier: novo
Product name: Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, E. coli)
Quantity: 1 mg
Other quantities: 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NGAL is produced by our E, coli expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 8 kD
UniProt number: P80188
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 um filtered solution of phosphate buffered saline, 4, 50% glycerol, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LCN2 (C-6His, Lipocalin-2, NGAL
Short name: E, LCN2 (C-6His, Lipocalin-2, coli), Recombinant NGAL
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: E, Lipocalin-2, coli), lipocalin 2 (C-6His, sapiens NGAL, recombinant H
Alternative technique: rec
Alternative to gene target: 24p3 and MSFI and NGAL, BT, Extracellular, LCN2 and IDBG-87415 and ENSG00000148346 and 3934, Lcn2 and IDBG-160059 and ENSMUSG00000026822 and 16819, protein homodimerization activity, this GO :0002020 and protease binding and molecular function this GO :0005215 and transporter activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006810 and transport and biological process this GO :0006811 and ion transport and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0009615 and response to virus and biological process this GO :0009617 and response to bacterium and biological process this GO :0009635 and response to herbicide and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0015891 and siderophore transport and biological process this GO :0031346 and positive regulation of cell projection organization and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031669 and cellular response to nutrient levels and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070207 and protein homotrimerization and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005215 : transporter activity and also this GO :0005506 : iron ion binding and also this GO :0005515 : protein binding and also this GO :0036094 : small molecule binding and also this GO :0042803 : protein homodimerization activity, this GO :0005215 : transporter activity, this GO :0005506 : iron ion binding, this GO :0005515 : protein binding, this GO :0036094 : small molecule binding, this GO :0042803 : protein homodimerization activity, 61865 and IDBG-639105 and ENSBTAG00000014149 and 526639, lipocalin 2
Identity: 6526
Gene: LCN2 | More about : LCN2
Long gene name: lipocalin 2
Synonyms gene name: lipocalin 2 (oncogene 24p3)
Synonyms: NGAL 24p3
Synonyms name: oncogene 24p3 neutrophil gelatinase-associated lipocalin siderocalin
Locus: 9q34, 11
Discovery year: 1994-04-29
Entrez gene record: 3934
Pubmed identfication: 7683678
RefSeq identity: NM_005564
Classification: Lipocalins
Havana BLAST/BLAT: OTTHUMG00000020734

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/