Recombinant Mouse Adiponectin, Acrp30, AdipoQ ((N-6His, E. coli)

Contact us
Catalog number: CH26
Price: 536 €
Supplier: adi
Product name: Recombinant Mouse Adiponectin, Acrp30, AdipoQ ((N-6His, E. coli)
Quantity: 100 μL
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Adiponectin is produced by our E, coli expression system and the target gene encoding Glu18-Asn247 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 27
UniProt number: Q60994
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Acrp30, AdipoQ (N-6His, Adiponectin
Short name: Acrp30, AdipoQ ((N-6His, E, coli), Recombinant Mouse Adiponectin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Mouses, coli, coli, E
Alternative name: Acrp30, C1Q and collagen domain containing ((N-6His, E, adiponectin, coli), recombinant Mouse Adiponectin
Alternative technique: rec

Related Products :

CH26 Recombinant Mouse Adiponectin, Acrp30, AdipoQ ((N-6His, E. coli) 10 µg 146 € novo e-coli
CI89 Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells) 500 µg 1613 € novo human
C552 Recombinant Human Adiponectin, ACRP30, ADIPOQ (C-6His) 1 mg 2283 € novo human
ACRP310-TR-10 Mouse recombinant (HEK) purified Acrp30/Adiponectin protein, Trimeric 10 μg 478 € adi mouse
ACRP310-TR-5 Mouse recombinant (HEK) purified Acrp30/Adiponectin protein, Trimeric 5 μg 333 € adi mouse
RP-1815H Recombinant Human ADIPOQ /Adiponectin Protein 100ug 642 € adv human
103-M214 Anti-Mouse Adiponectin (Acrp30) 100ug 336 € Reliatech antibodies mouse
ZP-3551 Adiponectin / ACRP30 Peptide 0.05 mg 204 € Zyagen human
XA-1016 anti-ACRP30 / Adiponectin Antibody [Ne.Na] 0.1 mg 180 € proscience human
101-M212 Anti-Human Adiponectin (ACRP30) 100ug 336 € Reliatech antibodies human
E-EL-C0012 Canine ADP/Acrp30 (Adiponectin) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0060 Chicken ADP/Acrp30 (Adiponectin) ELISA Kit 96T 497 € elabsciences chicken
GWB-AE3F42 Adiponectin C1Q And Collagen Domain Containing (ADIPOQ) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
AE23984HA-48 ELISA test for Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) 1x plate of 48 wells 402 € abebio hamster
AE23984HA-96 Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) ELISA Kit 1x plate of 96 wells 671 € abebio hamster
GENTAUR-58bd58a62625a Human Adiponectin (ADIPOQ) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd58a67ebe5 Human Adiponectin (ADIPOQ) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd58a6d23bc Human Adiponectin (ADIPOQ) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bd58a71c926 Human Adiponectin (ADIPOQ) 1000ug 2194 € MBS Recombinant Proteins human
ACRP301-C Mouse purified recombinant (E.Coli) Acrp30 protein (a.a 111-247) control for WB 100 μL 333 € adi mouse
ACRP305-R-25 Mouse purified recombinant (E.Coli, his-tag) Acrp30 protein (full length) for ELISA 25 μg 449 € adi mouse
ZR-40-326 Acrp30 Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-327 Acrp30 Recombinant Protein 0.005 mg 256 € Zyagen human
ACRP302-R-10 Human purified, recombinant (E.Coli, his-tag) Acrp30 protein, full length 10 μg 478 € adi human
ACRP302-R-5 Human purified, recombinant (E.Coli, his-tag) Acrp30 protein, full length 5 μg 333 € adi human
ACRP302-C Human purified, recombinant (E.Coli, his-tag) Acrp30 protein (full length) control for WB 100 μL 333 € adi human
ACRP301-P Mouse Acrp30 (adipocyte complement-related protein of 30 kDa) control/blocking peptide # 1 100 μg 188 € adi mouse
ACRP311-M Mouse monoclonal anti-Human Acrp30/adiponcetin protein IgG purified 100 μg 565 € adi human
ACRP301-A Rabbit Anti-Mouse Acrp30 (adipocyte complement-related protein of 30 kDa) 100 μg 565 € adi mouse
ACRP301-S Rabbit Anti-Mouse Acrp30 (adipocyte complement-related protein of 30 kDa) 100 μL 536 € adi mouse