Recombinant Human Galectin-7, LGALS7 (E. coli)

Contact us
Catalog number: C069
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Galectin-7, LGALS7 (E. coli)
Quantity: bulk
Other quantities: 10 µg 141€ 50 µg 303€ 500 µg 1115€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-7 is produced by our E, coli expression system and the target gene encoding Met1-Phe136 is expressed
Molecular Weight: 14, 9 kD
UniProt number: P47929
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LGALS7, Galectin-7
Short name: LGALS7 (E, coli), Recombinant Galectin-7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: LGALS7 (E, coli), sapiens Galectin-7, recombinant H
Alternative technique: rec
Identity: 6568
Gene: LGALS7 | More about : LGALS7
Long gene name: galectin 7
Synonyms gene name: 7 , galactoside-binding, lectin, soluble
Synonyms: GAL7 PIG1 TP53I1 LGALS7A
Locus: 19q13, 13
Discovery year: 1995-05-25
GenBank acession: L07769
Entrez gene record: 3963
Pubmed identfication: 7534301 7729568
RefSeq identity: NM_002307
Classification: Galectins
Havana BLAST/BLAT: OTTHUMG00000182606

Related Products :

C069 Recombinant Human Galectin-7, LGALS7 (E. coli) 500 µg 1115 € novo e-coli
RP-0722H Recombinant Human Galectin-7 / LGALS7 Protein (GST Tag) 50μg 624 € adv human
GWB-P0279F Lgals7, 1-136aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P1052L LGALS7, 1-136aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP026 LGALS7 Human Protein bulk Ask price € genways bulk human
LV204545 LGALS7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV204546 LGALS7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV204547 LGALS7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV204548 LGALS7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV204550 LGALS7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV204549 LGALS7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human
AR50583PU-N anti-Lgals7 (1-136, His-tag) Antibody 0,5 mg 1109 € acr human
AR50583PU-S anti-Lgals7 (1-136, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58be10a9813a7 Anti- LGALS7 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be10a9e2919 Anti- LGALS7 Antibody 0.06 ml 265 € MBS Polyclonals human
abx922480 Anti-LGALS7 siRNA inquire 50 € abbex human
abx922481 Anti-LGALS7 siRNA inquire 50 € abbex human
GWB-MX083B LGALS7 antibody 1 vial 521 € genways human
C068 Recombinant Human Galectin-3, LGALS3 (E. coli) 50 µg 192 € novo e-coli
C081 Recombinant Human Galectin-8, LGALS8 (E. coli) 50 µg 303 € novo e-coli
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
GWB-7C20E5 Recombinant Human Galectin-1 bulk Ask price € genways bulk human
GWB-BEA2B0 recombinant HUMAN GALECTIN-1 1 vial 614 € genways human
GWB-BIG08F Recombinant Human Galectin-1 bulk Ask price € genways bulk human
C285 Recombinant Human Galectin-1, LGALS1 (C-6His) 50 µg 496 € novo human
C803 Recombinant Human Galectin-14, LGALS14 (C-6His) 10 µg 202 € novo human
GWB-135C30 Recombinant Human Galectin-3 500 ug 662 € genways bulk human
GWB-BIG090 Recombinant Human Galectin-3 bulk Ask price € genways bulk human
GWB-E7CEE0 recombinant HUMAN GALECTIN-3 1 vial 614 € genways human
GWB-A27E9A Recombinant Human Galectin-3 His Tag bulk Ask price € genways bulk human