Recombinant Human Galectin-7, LGALS7 (E. coli)

Contact us
Catalog number: C069
Price: 1674 €
Supplier: novo
Product name: Recombinant Human Galectin-7, LGALS7 (E. coli)
Quantity: 1 mg
Other quantities: 10 µg 141€ 50 µg 303€ 500 µg 1115€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-7 is produced by our E, coli expression system and the target gene encoding Met1-Phe136 is expressed
Molecular Weight: 14, 9 kD
UniProt number: P47929
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LGALS7, Galectin-7
Short name: LGALS7 (E, coli), Recombinant Galectin-7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: LGALS7 (E, coli), sapiens Galectin-7, recombinant H
Alternative technique: rec
Identity: 6568
Gene: LGALS7 | More about : LGALS7
Long gene name: galectin 7
Synonyms gene name: 7 , galactoside-binding, lectin, soluble
Synonyms: GAL7 PIG1 TP53I1 LGALS7A
Locus: 19q13, 13
Discovery year: 1995-05-25
GenBank acession: L07769
Entrez gene record: 3963
Pubmed identfication: 7534301 7729568
RefSeq identity: NM_002307
Classification: Galectins
Havana BLAST/BLAT: OTTHUMG00000182606

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/