Recombinant Human Interleukin-4, IL-4 (E. coli)

Contact us
Catalog number: C050
Price: 346 €
Supplier: adv
Product name: Recombinant Human Interleukin-4, IL-4 (E. coli)
Quantity: 5μg
Other quantities: 1 mg 1836€ 10 µg 168€ 50 µg 405€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-4 is produced by our E, coli expression system and the target gene encoding His25-Ser153 is expressed
Molecular Weight: 1 kD, 15
UniProt number: P05112
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-4, Interleukin-4
Short name: IL-4 (E, coli), Recombinant Interleukin-4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: Interleukin-4 (E, coli), sapiens Interleukin-4, recombinant H
Alternative technique: rec
Identity: 6014
Gene: IL4 | More about : IL4
Long gene name: interleukin 4
Synonyms: BSF1 IL-4 BCGF1 BCGF-1 MGC79402
Synonyms name: B_cell stimulatory factor 1 lymphocyte stimulatory factor 1 B cell growth factor 1
Locus: 5q31, 1
Discovery year: 1988-08-10
GenBank acession: M23442
Entrez gene record: 3565
Pubmed identfication: 3016727
RefSeq identity: NM_000589
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000059724

Related Products :

C050 Recombinant Human Interleukin-4, IL-4 (E. coli) 500 µg 1298 € novo e-coli
MBS624348 IL6ST, phosphorylated (Tyr905) (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621212 Interleukin 1 Receptor AcP, C2 (IL1RacP, IL-1 Receptor Accessory Protein, IL-1RAP, FLJ37788, IL1R3, Interleukin 1 Accessory Protein) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS611936 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS612345 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 50ug 382 € MBS Polyclonals_1 human
GWB-2163DF INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 1 x 1 vial 752 € genways human
MBS622653 IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS617327 NFIL3 (E4 Promoter Binding Protein 4, E4BP4, E4BP4 Protein, Interleukin 3 Binding Protein 1, IL3BP1, Interleukin 3 Promoter Transcriptional Activator, NFIL3A, Nuclear Factor Interleukin 3 Regulated, Transcriptional Activator NF-IL3A) Antibody 100ug 591 € MBS Polyclonals_1 human
C047 Recombinant Mouse Interleukin-22, IL-22 (E. coli) 10 µg 202 € novo e-coli
CS27 Recombinant Human Interleukin-17F, IL-17F (Human Cells) 10 µg 156 € novo human
CD03 Recombinant Human Interleukin-4, IL-4 (Human Cells) 50 µg 339 € novo human
OMPC15-R-50 Recombinant (E. coli) Outer membrane protein C Recombinant Protein (ompC/omp1b/porin, 22-367 aa, E. coli, >95%) 25 μg 333 € adi e-coli
GWB-P0143M Interleukin-1 receptor antagonist, Human, Recombinant Protein bulk Ask price € genways bulk human
GWB-1C2E78 Interleukin-13 (IL-13) Human recombinant 1 x 1 vial 579 € genways human
GWB-P0132B Interleukin-15, 49-162aa Human, His-tagged, Recombinant Protein bulk Ask price € genways bulk human
GWB-3976FE Interleukin-16 (IL-16) Human recombinant 1 x 1 vial 579 € genways human
GWB-687DBE Interleukin-16 (IL-16), Human, recombinant 1 tube 524 € genways human
GWB-P0130M Interleukin-18 Human, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0141K Interleukin-2 (C145S) Human, Recombinant Protein bulk Ask price € genways bulk human
MAS612p Interleukin 2 (IL-2), natural & recombinant, Clone: GE14, Mouse Monoclonal antibody-Human; frozen, IH/ELISA/IA 0.5 mg Ask price € accurate-monoclonals human
GWB-P0136F Interleukin-3, 20-152aa Human, His-tagged, Recombinant Protein bulk Ask price € genways bulk human
MAS614p Interleukin 4 (IL-4), natural & recombinant, Clone: IL-4-5, Mouse Monoclonal antibody-Human, Inhibits activity; frozen, IH/ELISA/IA 0.2mg Ask price € accurate-monoclonals human
YM5017 Interleukin 6 (IL-6), natural & recombinant, Clone: MP5-32C11, Mouse Monoclonal antibody-Mouse (NO X w/Human or Rat); IA/IP/Inhibition 0.1mg 1004 € accurate-monoclonals rat
GWB-P0134D Interleukin-8 Human, Recombinant Protein bulk Ask price € genways bulk human
801023 LIMITED QTY-rhIL-2 Recombinant Human Interleukin-2 10,000 Units 328 € Natrols and viral diagnostic antigens human
RP-0859H Recombinant Human IL-15 / IL15 / Interleukin 15 Protein 10μg 456 € adv human
RP-0895H Recombinant Human IL-21R / Interleukin-21 Receptor Protein (His Tag) 100μg 624 € adv human
RP-1745H Recombinant Human IL19 / Interleukin-19 Protein (His Tag) 20μg 508 € adv human
RP-0896H Recombinant Human IL22 / IL-22 / Interleukin 22 Protein 10μg 346 € adv human
RP-0900H Recombinant Human IL27 / Interleukin-27 Protein (His Tag) 5μg 346 € adv human