Recombinant Mouse Interleukin-22, IL-22 (E. coli)

Contact us
Catalog number: C047
Price: 496 €
Supplier: novo
Product name: Recombinant Mouse Interleukin-22, IL-22 (E. coli)
Quantity: 50 µg
Other quantities: 1 mg 2729€ 10 µg 202€ 500 µg 1927€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-22 is produced by our E, coli expression system and the target gene encoding Leu34-Val179 is expressed
Molecular Weight: 16, 7 kD
UniProt number: Q9JJY9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-22, Interleukin-22
Short name: IL-22 (E, coli), Recombinant Mouse Interleukin-22
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Mouses, coli, coli, E
Alternative name: Interleukin-22 (E, coli), recombinant Mouse Interleukin-22
Alternative technique: rec
Identity: 5984
Gene: IL17D | More about : IL17D
Long gene name: interleukin 17D
Synonyms: IL-22 IL-27 IL-17D IL27 FLJ30846
Synonyms name: interleukin 27
Locus: 13q12, 11
Discovery year: 2000-05-02
GenBank acession: AY078238
Entrez gene record: 53342
Pubmed identfication: 12097364
RefSeq identity: NM_138284
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000016521

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/