| known also as: |
Anti-Rabbit Polyclonal (IgG) to Bovine PGIS / PTGIS |
| known also as: |
Rabbit PAb (IgG) to Bovine PGIS / PTGIS |
| known also as: |
Lapin Polyclonal (IgG) to Bovinae PGIS / PTGIS |
| known also as: |
PGIS / PTGIS |
| known also as: |
Bovine PGIS, CYP8, CYP8A1, PGIS, PTGI, PTGIS, PTGIS, Prostacyclin synthase, Prostaglandin I2 synthase, Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus |
| Other names: |
Prostacyclin synthase, Prostaglandin I2 synthase, cytochrome P450, family 8, polypeptide 1, prostacyclin synthase, prostaglandin I2 (prostacyclin) synthase, prostaglandin I2 synthase, subfamily A, prostacyclin synthase |
| Gene name: |
PGIS |
| Gene name synonims: |
PTGIS |
| Other gene names: |
CYP8, CYP8, CYP8A1, CYP8A1, PGIS, PTGI, PTGIS, PTGIS |
| Category: |
Antibodies |
| Clonality: |
Polyclonal |
| Immunoglobulin isotype: |
IgG |
| Clone: |
Polyclonal antibody |
| Host organism: |
Rabbit |
| Species reactivity: |
Human, Bovine |
| Specificity and cross-reactivity: |
2, 3, Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1 |
| Purification method: |
Immunoaffinity Purified |
| Form/Appearance: |
0, 0, 50% glycerol, pH 7, 02% sodium azide, 4, 5% BSA, TBS |
| Concentration: |
2 mg/ml |
| Storage and shipping: |
Avoid repeat freeze-thaw cycles, Short term: +Store productone at +4 degrees Celsius, Long term: Store productone at -20 degrees Celsius |
| Tested for:: |
Immunoprecipitation (IP), Western Blot (WB), Immunohistochemistry (IHC - Paraffin) |
| Description: |
Polyclonal antibodies generally are more stable and retain their reactivity under unfavorable conditions, Polyclonal antibodies have series of advantages - larger batches can be supplied at a time, Properly used, To obtain more detailed information on productone, please, refer to the full product datasheet, the time needed for production is considerably shorter, they are inexpensive to manufacture and respectively to buy, this antibody will ensure excellent and reproducible results with guaranteed success for the applications that it is tested in, productone is a polyclonal antibody of high purity and binding affinity for the antigen that it is risen against |
| Advisory: |
For antibodies that are in liquid form or reconstituted lyophilized antibodies small amounts could become entrapped on the seal or the walls of the tube, Prior to use briefly centrifuge the vial to gather all the solution on the bottom, avoid cycles of freezing and thawing, please, In order to retain the quality and the affinity of productone unchanged |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by MBS Polyclonals_1 they should be stored frozen at - 24° |
| About: |
2 light chains, For storage sodium azide is added or you can call us to request azide free antibody preparations, IgG, The IgG antibody has 2 , There are 2 heavy chains, These will need colder storage temperatures, They represent 70% or more of , This antibody can be antigen purified or protein A or G purified, goat polyclonal antibodies , mouse monoclonal H&, Immunoglobulin gamma, L chain clones or rabbit, antibodies, antigen , binding sites, have 4 parts, serum |
| Gene target: |
PAb PGIS / PTGIS |
| Short name: |
PAb (IgG) PGIS / PTGIS Antibody |
| Technique: |
IgGs, antibodies against human proteins, antibodies for, Antibody |
| Isotype: |
IgG |
| Species: |
Bos Taurus genes are available form the Bovine Genome database, Bovine |
| Alternative name: |
polyclonal (Immunoglobulin G) to Bovine PGIS / prostaglandin I2 (prostacyclin) synthase (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
CYP8 and CYP8A1 and PGIS and PTGI, PTGIS and IDBG-643178 and ENSBTAG00000017537 and 101910090, PTGIS and IDBG-80513 and ENSG00000124212 and 5740, Ptgis and IDBG-213024 and ENSMUSG00000017969 and 19223, acting on paired donors, acting on paired donors, acting on paired donors, nuclei, oxidoreductase activity, this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0004497 and monooxygenase activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006690 and icosanoid metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0008116 and prostaglandin-I synthase activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016705 and oxidoreductase activity, this GO :0004497 : monooxygenase activity, this GO :0004497 : monooxygenase activity and also this GO :0005506 : iron ion binding and also this GO :0005515 : protein binding and also this GO :0008116 : prostaglandin-I synthase activity and also this GO :0016705 : oxidoreductase activity, this GO :0005506 : iron ion binding, this GO :0005515 : protein binding, this GO :0008116 : prostaglandin-I synthase activity, this GO :0016705 : oxidoreductase activity, this GO :0020037 : heme binding, with incorporation or reduction of molecular oxygen, with incorporation or reduction of molecular oxygen and also this GO :0020037 : heme binding, with incorporation or reduction of molecular oxygen and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0020037 and heme binding and molecular function this GO :0032088 and negative regulation of NF-kappaB transcription factor activity and biological process this GO :0035360 and positive regulation of peroxisome proliferator activated receptor signaling pathway and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045019 and negative regulation of nitric oxide biosynthetic process and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :1900119 and positive regulation of execution phase of apoptosis and biological process, 282021, prostaglandin I2 (prostacyclin) synthase |
| Identity: |
9603 |
| Gene: |
PTGIS |
More about : PTGIS |
| Long gene name: |
prostaglandin I2 synthase |
| Synonyms gene name: |
prostaglandin I2 (prostacyclin) synthase |
| Synonyms: |
PGIS CYP8A1 |
| Synonyms name: |
cytochrome P450, family 8, polypeptide 1 prostacyclin synthase , subfamily A |
| Locus: |
20q13, 13 |
| Discovery year: |
1994-07-28 |
| Entrez gene record: |
5740 |
| Pubmed identfication: |
8812456 |
| Classification: |
Cytochrome P450 family 8 |
| Havana BLAST/BLAT: |
OTTHUMG00000033077 |
| Locus Specific Databases: |
Human Cytochrome P450 (CYP) Allele Nomenclature Committee |