| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Signal-Regulatory Protein alpha 1 is produced by our Mammalian expression system and the target gene encoding Lys32-Asn372 is expressed with a MIgG2a tag at the C-terminus |
| Molecular Weight: |
1 kD, 65 |
| UniProt number: |
Q6P6I8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD172a (C-MIgG2a), SIRPA, -1, Signal-Regulatory Protein &alpha |
| Short name: |
CD172a (C-MIgG2a), SIRPA, -1, Recombinant Mouse Signal-Regulatory Protein &alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
CD172a (C-MIgG2a), signal-regulatory protein a, -1, recombinant Mouse Signal-Regulatory Protein &alpha |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, SH3 domain binding, SIRPA and IDBG-40694 and ENSG00000198053 and 140885, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017124 and SH3 domain binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0017124 : SH3 domain binding, this GO :0017124 : SH3 domain binding, signal-regulatory protein alpha |
| Identity: |
9662 |
| Gene: |
SIRPA |
More about : SIRPA |
| Long gene name: |
signal regulatory protein alpha |
| Synonyms gene: |
PTPNS1 |
| Synonyms gene name: |
non-receptor type substrate 1 signal-regulatory protein alpha , protein tyrosine phosphatase |
| Synonyms: |
SHPS1 SIRP MYD-1 BIT P84 SHPS-1 SIRPalpha CD172a SIRPalpha2 MFR SIRP-ALPHA-1 |
| Locus: |
20p13 |
| Discovery year: |
1999-03-19 |
| GenBank acession: |
D86043 |
| Entrez gene record: |
140885 |
| Pubmed identfication: |
9070220 9062191 16339511 |
| RefSeq identity: |
NM_080792 |
| Classification: |
C1-set domain containing CD molecules Signal regulatory proteins V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031682 |