Recombinant Rat IgG2A Fc, Igg-2a

Catalog number:	CM97 Buy Now
Price:	454 €
Supplier:	accurate-monoclonals
Product name:	Recombinant Rat IgG2A Fc, Igg-2a
Quantity:	500ul
Other quantities:	1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:	rat recombinant igga rats alternative description

More details Need more?:

Reacts with:	Rat
Source:	proteins, Recombinants or rec
Description:	Recombinant Rat Immunoglobulin G2A Fc is produced by our Mammalian expression system and the target gene encoding Val98-Lys322 is expressed
Molecular Weight:	2 kD, 35
UniProt number:	P20760
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	pH 8, 2 um filtered solution of 20 mM Tris, 5, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	VPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
About:	Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus
Latin name:	Rattus norvegicus
Group:	recombinants
Gene target:	2a, IgG2A Fc
Short name:	Igg-2a, Recombinant IgG2A Fc
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host:	Rat
Species:	Rats, Rat
Alternative name:	Immunoglobulin G-2a, recombinant Rat IgG2A fragment c
Alternative technique:	rec

• #rat
• #recombinant
• #igga
• #rats
• #alternative
• #description