| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human/Mouse/Rat Irisin is produced by our Mammalian expression system and the target gene encoding Asp32-Glu143 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13, 6 kD |
| UniProt number: |
Q8NAU1 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Rattus norvegicus, Mus musculus |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Group: |
recombinants |
| Gene target: |
FNDC5 (C-6His), Irisin |
| Short name: |
FNDC5 (C-6His), Irisin, Recombinant Mouse |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Humans, Mouses, Rats, Rat |
| Alternative name: |
FNDC5 (C-6His), Mouse, Rat Irisin, sapiens, recombinant H |
| Alternative technique: |
rec |
| Identity: |
20240 |
| Gene: |
FNDC5 |
More about : FNDC5 |
| Long gene name: |
fibronectin type III domain containing 5 |
| Synonyms: |
FRCP2 |
| Synonyms name: |
irisin |
| Locus: |
1p35, 1 |
| Discovery year: |
2004-01-13 |
| GenBank acession: |
AK092102 |
| Entrez gene record: |
252995 |
| Pubmed identfication: |
12384288 22237023 24120943 |
| RefSeq identity: |
NM_153756 |
| Classification: |
Fibronectin type III domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000004015 |