Recombinant Rat Fibroblast Growth Factor 2, FGF2, FGFb

Contact us
Catalog number: CM25
Price: 883 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Rat Fibroblast Growth Factor 2, FGF2, FGFb
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Rat
Source: proteins, Recombinants or rec
Description: Recombinant Rat Fibroblast growth factor 2 is produced by our E, coli expression system and the target gene encoding Ala11-Ser154 is expressed
Molecular Weight: 16, 2 kD
UniProt number: P13109
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus 
Latin name: Rattus norvegicus
Group: recombinants
Gene target: FGF2, FGFb, Fibroblast Growth Factor 2
Short name: FGF2, FGFb, Recombinant Fibroblast Growth Factor 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rat
Species: Rats, Rat
Alternative name: FGFb, fibroblast growth factor 2 (basic), recombinant Rat Fibroblast Growth Factor 2
Alternative technique: rec
Alternative to gene target: BFGF and FGF-2 and FGFB and HBGF-2, BT, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046668 and regulation of retinal cell programmed cell death and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048598 and embryonic morphogenesis and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048678 and response to axon injury and biological process this GO :0048864 and stem cell development and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0051209 and release of sequestered calcium ion into cytosol and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060045 and positive regulation of cardiac muscle cell proliferation and biological process this GO :0060128 and corticotropin hormone secreting cell differentiation and biological process this GO :0060129 and thyroid-stimulating hormone-secreting cell differentiation and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0060591 and chondroblast differentiation and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0060978 and angiogenesis involved in coronary vascular morphogenesis and biological process this GO :0061045 and negative regulation of wound healing and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0090263 and positive regulation of canonical Wnt signaling pathway and biological process, FGF2 and IDBG-37039 and ENSG00000138685 and 2247, Fgf2 and IDBG-140464 and ENSMUSG00000037225 and 14173, chemoattractant activity, nuclei, this GO :0000186 and activation of MAPKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001525 and angiogenesis and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001759 and organ induction and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002042 and cell migration involved in sprouting angiogenesis and biological process this GO :0005104 and fibroblast growth factor receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006661 and phosphatidylinositol biosynthetic process and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007568 and aging and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009792 and embryo development ending in birth or egg hatching and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010001 and glial cell differentiation and biological process this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010764 and negative regulation of fibroblast migration and biological process this GO :0010863 and positive regulation of phospholipase C activity and biological process this GO :0021762 and substantia nigra development and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030214 and hyaluronan catabolic process and biological process this GO :0030324 and lung development and biological process this GO :0030374 and ligand-dependent nuclear receptor transcription coactivator activity and molecular function this GO :0032958 and inositol phosphate biosynthetic process and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042060 and wound healing and biological process this GO :0042660 and positive regulation of cell fate specification and biological process this GO :0043536 and positive regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0043552 and positive regulation of phosphatidylinositol 3-kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, this GO :0005104 : fibroblast growth factor receptor binding, this GO :0005104 : fibroblast growth factor receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding and also this GO :0030374 : ligand-dependent nuclear receptor transcription coactivator activity and also this GO :0042056 : chemoattractant activity, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, this GO :0030374 : ligand-dependent nuclear receptor transcription coactivator activity, this GO :0042056 : chemoattractant activity, 66957 and IDBG-630303 and ENSBTAG00000005691 and 281161, fibroblast growth factor 2 (basic)
Identity: 3676
Gene: FGF2 | More about : FGF2
Long gene name: fibroblast growth factor 2
Synonyms gene: FGFB
Synonyms gene name: fibroblast growth factor 2 (basic)
Locus: 4q28, 1
Discovery year: 1986-01-01
GenBank acession: J04513
Entrez gene record: 2247
Pubmed identfication: 9925931
RefSeq identity: NM_002006
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000039506

Related Products :

MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
CM25 Recombinant Rat Fibroblast Growth Factor 2, FGF2, FGFb 500 µg 1613 € novo rat
C046 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Gly132-Ser288) 10 µg 100 € novo human
C751 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Met134-Ser288) 1 mg 2283 € novo human
C779 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Pro143-Ser288) 500 µg 1613 € novo human
C044 Recombinant Mouse Fibroblast Growth Factor 2, FGF-2, FGFb (Met1-Ser154) 1 mg 943 € novo mouse
GWB-8D4EB8 antibody to or anti- Fibroblast Growth Factor-Basic (FGFb) antibody 1 vial 521 € genways human
MBS623379 Fibroblast Growth Factor, Basic (FGFb) Antibody 50ug 426 € MBS Polyclonals_1 human
OBT4849 Fibroblast Growth Factor Basic (FGFb), Not suitable for detecting bFGF bound to cell surface receptors, Clone: MC-GF1, Mouse Monoclonal antibody-Human; frozen, IH/ELISA 0.5 mg Ask price € accurate-monoclonals human
MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
DL-FGF2-Ra Rat Fibroblast Growth Factor 2, Basic FGF2 ELISA Kit 96T 730 € DL elisas rat
GENTAUR-58bc6da806593 Rat Fibroblast growth factor 2 (Fgf2) 100ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58bc6da855cda Rat Fibroblast growth factor 2 (Fgf2) 1000ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58bc6da8a472c Rat Fibroblast growth factor 2 (Fgf2) 100ug 1989 € MBS Recombinant Proteins rat
GENTAUR-58bc6da8efe36 Rat Fibroblast growth factor 2 (Fgf2) 1000ug 1989 € MBS Recombinant Proteins rat
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human
GENTAUR-58bdc30333bb7 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdc303a2b72 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc7e0ebd61 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc7e15b93c Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc971beb82 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58bdd1e123f6a Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd3dd5e120 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdd6c56b564 Anti- Fibroblast Growth Factor 2, Basic (FGF2) Antibody 100ug 553 € MBS Polyclonals human
DL-FGF2-b Bovine Fibroblast Growth Factor 2, Basic FGF2 ELISA Kit 96T 869 € DL elisas bovine
DL-FGF2-Ch Chicken Fibroblast Growth Factor 2, Basic FGF2 ELISA Kit 96T 788 € DL elisas chicken
EKU04148 Fibroblast Growth Factor 2, Basic (FGF2) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human