Recombinant Rat VEGF-A, VEGF164

Contact us
Catalog number: CJ96
Price: 448 €
Supplier: accurate-monoclonals
Product name: Recombinant Rat VEGF-A, VEGF164
Quantity: 200ug
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Rat
Source: proteins, Recombinants or rec
Description: Recombinant Rat Vascular Endothelial Growth Factor A is produced by our Yeast expression system and the target gene encoding Ala27-Arg190 is expressed
Molecular Weight: 19, 2 kD
UniProt number: P16612-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus 
Latin name: Rattus norvegicus
Group: recombinants
Gene target: VEGF164, VEGF-A
Short name: VEGF164, Recombinant VEGF-A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rat
Species: Rats, Rat
Alternative name: VEGF164, recombinant Rat VEGF-A
Alternative technique: rec
Identity: 12680
Gene: VEGFA | More about : VEGFA
Long gene name: vascular endothelial growth factor A
Synonyms gene: VEGF
Synonyms gene name: vascular endothelial growth factor
Synonyms: VEGF-A VPF
Locus: 6p21, 1
Discovery year: 1994-01-10
GenBank acession: AB021221
Entrez gene record: 7422
Pubmed identfication: 8786112
RefSeq identity: NM_001025366
Classification: VEGF family
Havana BLAST/BLAT: OTTHUMG00000014745
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

VEGF33-R-10 Rat Recombinant VEGF164 (VEGF-A) Protein (E.Coli), biologically active 10 μg 521 € adi rat
VEGF33-R-100 Rat Recombinant VEGF164 (VEGF-A) Protein (E.Coli), biologically active 100 μg 2943 € adi rat
CJ96 Recombinant Rat VEGF-A, VEGF164 50 µg 496 € novo rat
VEGF34-R-10 Mouse Recombinant VEGF164 (VEGF-A) Protein (Sf9), biologically active 10 μg 521 € adi mouse
VEGF34-R-100 Mouse Recombinant VEGF164 (VEGF-A) Protein (Sf9), biologically active 100 μg 2943 € adi mouse
CD73 Recombinant Mouse VEGF-A, VEGF164 10 µg 202 € novo mouse
AR26015PU-L anti-VEGF-A (VEGF164) Antibody 20 Вµg 543 € acr human
AR26015PU-N anti-VEGF-A (VEGF164) Antibody 5 Вµg 355 € acr human
AR26015PU-S anti-VEGF-A (VEGF164) Antibody 2 Вµg 297 € acr human
AR31052PU-L anti-VEGF-A (VEGF164) Antibody 20 Вµg 630 € acr human
AR31052PU-N anti-VEGF-A (VEGF164) Antibody 5 Вµg 355 € acr human
AR31052PU-S anti-VEGF-A (VEGF164) Antibody 2 Вµg 311 € acr human
CJ93 Recombinant Human VEGF Receptor 1, VEGF R1, FLT-1 (C-Fc) 500 µg 1115 € novo human
CJ92 Recombinant Human VEGF Receptor 2, VEGF R2, FLK-1, KDR (C-Fc) 500 µg 1115 € novo human
PR15034-25 anti-VEGF164 Antibody 25 Вµg 1399 € acr human
PR15034-5 anti-VEGF164 Antibody 5 Вµg 543 € acr human
PR15035-10 anti-VEGF164 Antibody 10 Вµg 630 € acr human
PR15035-50 anti-VEGF164 Antibody 50 Вµg 1515 € acr human
PR15034CF-25 anti-VEGF164 (Carrier Free) Antibody 25 Вµg 1399 € acr human
PR15034CF-5 anti-VEGF164 (Carrier Free) Antibody 5 Вµg 543 € acr human
PR15035CF-10 anti-VEGF164 (Carrier Free) Antibody 10 Вµg 630 € acr human
PR15035CF-50 anti-VEGF164 (Carrier Free) Antibody 50 Вµg 1515 € acr human
MBS619304 Vascular Endothelial Growth Factor 164 (VEGF164) 100ul 1277 € MBS Polyclonals_1 human
AP26032PU-L anti-VEGF-B (VEGF-B167) Antibody 0,2 mg 587 € acr human
AP26032PU-N anti-VEGF-B (VEGF-B167) Antibody 0,1 mg 442 € acr human
DA3520 anti-VEGF-C / Flt4-L (VEGF-C152S) Antibody 5 Вµg 326 € acr human
DA3520X anti-VEGF-C / Flt4-L (VEGF-C152S) Antibody 20 Вµg 456 € acr human
MBS615440 Vascular Endothelial Growth Factor C, Propeptide (VEGF-C, VEGF-A, Vascular permeability factor, VPF) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS612096 Vascular Endothelial Growth Factor, Mature (VEGF-C, VEGF-A, Vascular permeability factor, VPF) 100ug 663 € MBS Polyclonals_1 human
DEVAS1721 Vascular Endothelial Growth Factor (VEGF), Clone: mxsghk-VEGF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human