| Reacts with: |
Rat |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Rat ErbB2 is produced by our E, coli expression system and the target gene encoding Ala67-Val323 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
29, 3 kD |
| UniProt number: |
P06494 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
4M Urea, pH 8, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Latin name: |
Rattus norvegicus |
| Group: |
recombinants |
| Gene target: |
ErbB2, HER2 (C-6His), Receptor Tyrosine-Protein Kinase ErbB-2 |
| Short name: |
ErbB2, HER2 (C-6His), Recombinant Receptor Tyrosine-Protein Kinase ErbB-2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Rats, Rat |
| Alternative name: |
HER2 (C-6His), neuro/glioblastoma derived oncogene homolog (avian), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, recombinant Rat Receptor Tyrosine-Protein phosphorylation catalyst ErbB-2 |
| Alternative technique: |
rec |
| Identity: |
3430 |
| Gene: |
ERBB2 |
More about : ERBB2 |
| Long gene name: |
erb-b2 receptor tyrosine kinase 2 |
| Synonyms gene: |
NGL |
| Synonyms gene name: |
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog) v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2 |
| Synonyms: |
NEU HER-2 CD340 HER2 |
| Synonyms name: |
neuro/glioblastoma derived oncogene homolog human epidermal growth factor receptor 2 |
| Locus: |
17q12 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X03363 |
| Entrez gene record: |
2064 |
| RefSeq identity: |
NM_004448 |
| Classification: |
CD molecules Minor histocompatibility antigens Erb-b2 receptor tyrosine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000179300 |
| Locus Specific Databases: |
LRG_724 |