| Reacts with: |
Rat |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Rat Stem Cell Factor is produced by our E, coli expression system and the target gene encoding Gln26-Ala189 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
19, 3 kD |
| UniProt number: |
P21581 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Latin name: |
Rattus norvegicus |
| Group: |
recombinants |
| Gene target: |
SCF (C-6His), Stem Factor |
| Short name: |
SCF (C-6His), Recombinant Stem Cell Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Rats, Rat |
| Alternative name: |
SCF (C-6His), recombinant Rat progenitor cellular Factor |
| Alternative technique: |
rec |
| Identity: |
6343 |
| Gene: |
KITLG |
More about : KITLG |
| Long gene name: |
KIT ligand |
| Synonyms gene: |
MGF |
| Synonyms: |
SCF SF Kitl KL-1 FPH2 |
| Synonyms name: |
mast cell growth factor stem cell factor steel factor familial progressive hyperpigmentation 2 |
| Locus: |
12q21, 32 |
| Discovery year: |
1991-06-04 |
| GenBank acession: |
M59964 |
| Entrez gene record: |
4254 |
| Pubmed identfication: |
2208279 1707188 19375057 |
| RefSeq identity: |
NM_003994 |
| Havana BLAST/BLAT: |
OTTHUMG00000169888 |