| Reacts with: |
Rat |
| Source: |
proteins, Recombinants or rec |
| Description: |
Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard |
| Molecular Weight: |
15, 6 kD |
| UniProt number: |
P48750 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline pH7, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CSF2 |
More about : CSF2 |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Latin name: |
Rattus norvegicus |
| Group: |
recombinants |
| Gene target: |
GM-CSF(C-6His), Granulocyte-Macrophage Colony-Stimulating Factor |
| Short name: |
GM-CSF(C-6His), Recombinant Granulocyte-Macrophage Colony-Stimulating Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Rats, Rat |
| Alternative name: |
GM-CSF(C-6His), recombinant Rat Granulocyte-Macrophage Colony-Stimulating Factor |
| Alternative technique: |
rec |
| Identity: |
2434 |
| Long gene name: |
colony stimulating factor 2 |
| Synonyms gene name: |
colony stimulating factor 2 (granulocyte-macrophage) |
| Synonyms: |
GM-CSF GMCSF |
| Synonyms name: |
sargramostim molgramostin granulocyte-macrophage colony stimulating factor |
| Locus: |
5q31, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M11734 |
| Entrez gene record: |
1437 |
| Pubmed identfication: |
3898082 2999978 |
| RefSeq identity: |
NM_000758 |
| Havana BLAST/BLAT: |
OTTHUMG00000059637 |