Recombinant Rat M-CSF, CSF1

Contact us
Catalog number: C470
Price: 528 €
Supplier: abbex
Product name: Recombinant Rat M-CSF, CSF1
Quantity: 15 nmol
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Rat
Source: proteins, Recombinants or rec
Description: Recombinant Rat Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Gln33-Arg254 is expressed
Molecular Weight: 2 kD, 25
UniProt number: Q8JZQ0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus 
Latin name: Rattus norvegicus
Group: recombinants
Gene target: CSF1, M-CSF
Short name: CSF1, Recombinant M-CSF
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rat
Species: Rats, Rat
Alternative name: colony stimulating factor 1 (macrophage), recombinant Rat M-CSF
Alternative technique: rec
Alternative to gene target: CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, Extracellular, protein homodimerization activity, this GO :0001503 and ossification and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0003006 and developmental process involved in reproduction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005157 and macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010743 and regulation of macrophage derived foam cell differentiation and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032946 and positive regulation of mononuclear cell proliferation and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042117 and monocyte activation and biological process this GO :0042476 and odontogenesis and biological process this GO :0042488 and positive regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045657 and positive regulation of monocyte differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0060611 and mammary gland fat development and biological process this GO :0060763 and mammary duct terminal end bud growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005157 : macrophage colony-stimulating factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0042803 : protein homodimerization activity, this GO :0005157 : macrophage colony-stimulating factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0042803 : protein homodimerization activity, colony stimulating factor 1 (macrophage)
Identity: 2432
Gene: CSF1 | More about : CSF1
Long gene name: colony stimulating factor 1
Synonyms gene name: colony stimulating factor 1 (macrophage)
Synonyms: M-CSF MCSF MGC31930
Synonyms name: macrophage colony stimulating factor 1
Locus: 1p13, 3
Discovery year: 1986-01-01
GenBank acession: BC021117
Entrez gene record: 1435
Pubmed identfication: 1540160
RefSeq identity: NM_000757
Havana BLAST/BLAT: OTTHUMG00000011646

Related Products :

C470 Recombinant Rat M-CSF, CSF1 50 µg 496 € novo rat
C417 Recombinant Human M-CSF, CSF1 (C-6His) 10 µg 202 € novo human
CB75 Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1 50 µg 496 € novo mouse
CB34 Recombinant Mouse M-CSF, CSF1 1 mg 2486 € novo mouse
C756 Recombinant Mouse M-CSF, CSF1 (C-6His) 1 mg 2486 € novo mouse
RP-1132RC Recombinant Rhesus M-CSF / CSF-1 Protein (Fc Tag) 10μg 572 € adv rhesus
RP-1131RC Recombinant Rhesus M-CSF / CSF-1 Protein (His Tag) 10μg 572 € adv rhesus
AR09315PU-L anti-M-CSF / CSF-1 (33-190, His-tag) Antibody 0,5 mg 1022 € acr human
AR09315PU-N anti-M-CSF / CSF-1 (33-190, His-tag) Antibody 0,1 mg 413 € acr human
AM06393SU-N anti-M-CSF / CSF-1 Antibody 0,1 ml 630 € acr human
AM09180PU-N anti-M-CSF / CSF-1 Antibody 0,5 mg 717 € acr human
AM09181PU-N anti-M-CSF / CSF-1 Antibody 0,5 mg 717 € acr human
AM26381PU-L anti-M-CSF / CSF-1 Antibody 0,5 mg 717 € acr human
AP17554PU-N anti-M-CSF / CSF-1 Antibody 0,4 ml 587 € acr human
AR09492PU-N anti-M-CSF / CSF-1 Antibody 10 Вµg 384 € acr human
AR09492PU-S anti-M-CSF / CSF-1 Antibody 2 Вµg 253 € acr human
BM4089 anti-M-CSF / CSF-1 Antibody 1 ml 775 € acr human
BM4089P anti-M-CSF / CSF-1 Antibody 0,1 mg 543 € acr human
PA102 anti-M-CSF / CSF-1 Antibody 2 Вµg 253 € acr human
PA102X anti-M-CSF / CSF-1 Antibody 10 Вµg 384 € acr human
PA268 anti-M-CSF / CSF-1 Antibody 2 Вµg 253 € acr human
PA268X anti-M-CSF / CSF-1 Antibody 10 Вµg 384 € acr human
PP1048B1 anti-M-CSF / CSF-1 Antibody 25 Вµg 384 € acr human
PP1048B2 anti-M-CSF / CSF-1 Antibody 50 Вµg 543 € acr human
PP1048P1 anti-M-CSF / CSF-1 Antibody 50 Вµg 384 € acr human
PP1048P2 anti-M-CSF / CSF-1 Antibody 0,1 mg 543 € acr human
PR27079-10 anti-M-CSF / CSF-1 Antibody 10 Вµg 471 € acr human
PR27079-2 anti-M-CSF / CSF-1 Antibody 2 Вµg 326 € acr human
abx912915 Anti-CSF1 siRNA 30 nmol 717 € abbex human
abx912916 Anti-CSF1 siRNA 15 nmol 528 € abbex human