Recombinant Mouse Basigin, CD147 (C-6His)

Contact us
Catalog number: CP80
Price: 597 €
Supplier: MBS mono
Product name: Recombinant Mouse Basigin, CD147 (C-6His)
Quantity: 50ug
Other quantities: 1 mg 1674€ 50 µg 303€ 500 µg 1186€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Basigin is produced by our Mammalian expression system and the target gene encoding Ala22-Arg325 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 34
UniProt number: P18572
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD147 (C-6His), Basigin
Short name: CD147 (C-6His), Recombinant Mouse Basigin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD147 (C-6His), recombinant Mouse Basigin
Alternative technique: rec
Identity: 1116
Gene: BSG | More about : BSG
Long gene name: basigin (Ok blood group)
Synonyms gene: OK
Synonyms gene name: basigin
Synonyms: EMMPRIN CD147
Synonyms name: Ok blood group
Locus: 19p13, 3
Discovery year: 1993-10-25
GenBank acession: L10240
Entrez gene record: 682
Pubmed identfication: 8404035 7812975
RefSeq identity: NM_001728
Classification: I-set domain containing Immunoglobulin like domain containing CD molecules Blood group antigens
Havana BLAST/BLAT: OTTHUMG00000177718
Locus Specific Databases: Blood Group Antigen Mutation Database LRG_816

Related Products :

CP80 Recombinant Mouse Basigin, CD147 (C-6His) 50 µg 303 € novo mouse
C433 Recombinant Human EMMPRIN, Basigin, CD147 (C-6His) 10 µg 131 € novo human
RP-1092M Recombinant Mouse CD147 / EMMPRIN / Basigin Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1093M Recombinant Mouse CD147 / EMMPRIN / Basigin Protein (His Tag) 50μg 624 € adv mouse
RP-0263H Recombinant Human CD147 / EMMPRIN / Basigin Protein 20μg 456 € adv human
RP-0262H Recombinant Human CD147 / EMMPRIN / Basigin Protein (Fc Tag) 50μg 624 € adv human
RP-0264H Recombinant Human CD147 / EMMPRIN / Basigin Protein (His Tag) 50μg 659 € adv human
ACLX76AP CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-; Clone: MEM-M6/1 0.1 mg 296 € accurate-monoclonals mouse
ACLX76APC CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-; Clone: MEM-M6/1, APC conj. 100 tests 410 € accurate-monoclonals mouse
ACLX76B CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-; Clone: MEM-M6/1, Biotin conj. 0.1 mg 353 € accurate-monoclonals mouse
ACLX76F CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-; Clone: MEM-M6/1, FITC conj. 100 tests 353 € accurate-monoclonals mouse
ACLX76PE CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-; Clone: MEM-M6/1, PE conj. 100 tests 410 € accurate-monoclonals mouse
ACLX345AP CD147/Basigin/Neurothelin, Mouse Monoclonal antibody-Human,Swine; Clone: MEM-M6/2 0.1 mg 296 € accurate-monoclonals human
YSRTMCA1876XZ CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human, azide-free 1 mg 1030 € accurate-monoclonals human
OBT4432F CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1876F CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg 404 € accurate-monoclonals human
OBT4432 CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human; flow/IP/WB 200ug Ask price € accurate-monoclonals human
YSRTMCA1876 CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human; flow/IP/WB 200ug 489 € accurate-monoclonals human
OBT4432R CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human, RPE; flow vial Ask price € accurate-monoclonals human
YSRTMCA1876PE CD147, Neurothelin, Basigin, Clone: MEM-M6/1, Mouse Monoclonal antibody-Human, RPE; flow vial 432 € accurate-monoclonals human
GENTAUR-58bde87474920 Mouse Monoclonal [clone 56.3_1D5] (IgG2b) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5becdf5e Mouse Monoclonal [clone HIM6] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5b32bd09 Mouse Monoclonal [clone MEM-M6/1] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde623091d7 Mouse Monoclonal [clone MEM-M6/1] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde635885c8 Mouse Monoclonal [clone MEM-M6/1] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5b453569 Mouse Monoclonal [clone MEM-M6/2] (IgG2b) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde6153993d Mouse Monoclonal [clone MEM-M6/6] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde72c01f20 Mouse Monoclonal [clone UM-8D6] (IgG1) to Human Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde636c2ab1 Rat Monoclonal [clone OX114] (IgG1) to Mouse Basigin / Emmprin / CD147 Antibody 0.125 miligrams 597 € MBS mono mouse
GENTAUR-58bde6e1e0836 Rat Monoclonal (IgG1) to Mouse Basigin / Emmprin / CD147 Antibody 50ug 597 € MBS mono mouse