| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Cytotoxic T-lymphocyte Protein 4 is produced by our Mammalian expression system and the target gene encoding Ala37-Asp161 is expressed with a Flag tag at the C-terminus |
| Molecular Weight: |
14, 7 kD |
| UniProt number: |
P09793 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDDYKDDDDK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
, Also separation of , FLAGS are also used in the isolation of , For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies, It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray, Suitable for in vivo use in cells, This FLAG-tags have the sequence DYKDDDDK motiv, because its mild purification procedure tends not to disrupt such complexes, or , or , overexpressed proteins from cell lysates is done by FLAG go HIS tags, An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, FLAG epitope that is a polypeptide , FLAG octapeptide, These tags are very useful to do protein purification by , affinity chromatography, protein complexes , protein tag , recombinant, recombinant DNA, that can be added to a protein using , with multiple subunits |
| Conjugation: |
Flag |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
Cytotoxic T-lymphocyte Protein 4(C |
| Short name: |
Recombinant Mouse Cytotoxic T-lymphocyte Protein 4(C- ) |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Label: |
Flag |
| Species: |
Mouses, Mouse |
| Alternative name: |
recombinant Mouse Cytotoxic T-lymphocyte Protein 4(C-Flag) |
| Alternative technique: |
rec |