| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Met23-Ser335 is expressed, Recombinant Mouse Interleukin-23 is produced by our Mammalian expression system and the target gene encoding Val22-Ala196& |
| Molecular Weight: |
19, 35, 7&, 8 kD |
| UniProt number: |
P43432, Q9EQ14& |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to_x005F_x0006_࢟࢟_x005F_x0005__x005F_x0006_ࢠࢠ_x005F_x0005__x005F_x0006_࢞࢞_x005F_x000F__x005F_x000F_, Always centrifuge tubes before opening, g/ml, ࠘耀 |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS, VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA& |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
IL-23, Interleukin-23 |
| Short name: |
IL-23, Recombinant Mouse Interleukin-23 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
Interleukin-23, recombinant Mouse Interleukin-23 |
| Alternative technique: |
rec |
| Identity: |
15488 |
| Gene: |
IL23A |
More about : IL23A |
| Long gene name: |
interleukin 23 subunit alpha |
| Synonyms gene name: |
alpha subunit p19 , interleukin 23 |
| Synonyms: |
SGRF IL23P19 IL-23 IL-23A P19 |
| Synonyms name: |
G-CSF related factor , interleukin-six |
| Locus: |
12q13, 3 |
| Discovery year: |
2001-04-10 |
| GenBank acession: |
AB030000 |
| Entrez gene record: |
51561 |
| Pubmed identfication: |
11114383 |
| RefSeq identity: |
NM_016584 |
| Classification: |
Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000187402 |