Recombinant Mouse SLAMF4, Natural killer cell receptor 2B4, CD244 (C-6His)

Contact us
Catalog number: CS28
Price: 402 €
Supplier: abebio
Product name: Recombinant Mouse SLAMF4, Natural killer cell receptor 2B4, CD244 (C-6His)
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 2 or 3 and , However, In this sense, The receptors are ligand binding factors of type 1, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, cell lines and tissues in culture till half confluency, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, For cells, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell
Molecular Weight: 23, 5 kD
UniProt number: Q07763
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD244 (C-6His), Natural killer receptor 2B4, SLAMF4
Short name: CD244 (C-6His), Natural killer receptor 2B4, Recombinant Mouse SLAMF4
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD244 molecule, Natural killer cellular receptor 2B4, natural killer cellular receptor 2B4 (C-6His), recombinant Mouse SLAMF4
Alternative technique: rec
Alternative to gene target: CD244 and IDBG-104114 and ENSG00000122223 and 51744, CD244 and IDBG-630400 and ENSBTAG00000002951 and 513468, Cd244 and IDBG-204694 and ENSMUSG00000004709 and 18106, Cell surfaces, natural killer cell receptor 2B4, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0050900 and leukocyte migration and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD244 molecule
Identity: 18171
Gene: CD244 | More about : CD244
Long gene name: CD244 molecule
Synonyms gene name: natural killer cell receptor 2B4 , natural killer cell receptor 2B4 CD244 natural killer cell receptor 2B4 CD244 molecule
Synonyms: 2B4 NAIL NKR2B4 Nmrk SLAMF4
Locus: 1q23, 3
Discovery year: 2003-10-23
GenBank acession: AF105261
Entrez gene record: 51744
Pubmed identfication: 3772297 10458320
RefSeq identity: NM_016382
Classification: Immunoglobulin like domain containing CD molecules
Havana BLAST/BLAT: OTTHUMG00000028606

Related Products :

CS28 Recombinant Mouse SLAMF4, Natural killer cell receptor 2B4, CD244 (C-6His) 1 mg 2283 € novo mouse
CS61 Recombinant Human Natural Killer Cell Receptor 2B4, SLAMF4, CD244 (C-6His) 10 µg 141 € novo human
MBS616114 Peroxiredoxin 2 (Peroxiredoxin-2, PRDX2, PRDX-2, PRX2, PRXII, HGNC:9353, MGC4104, Natural Killer Cell Enhancing Factor B, Natural Killer Enhancing Factor B, NKEFB, NKEF-B, PRP, Thiol Specific Antioxidant 1, Thiol-specific Antioxidant Protein, TSA, Thiored 100ug 735 € MBS Polyclonals_1 human
abx167358 Anti-Natural Killer Cell Receptor 2B4 Protein (Recombinant) 100 μg 862 € abbex human
abx129398 Anti-Natural Killer Cell Receptor 2B4 Antibody 100 μg 514 € abbex human
RP-0299H Recombinant Human 2B4 / SLAMF / CD244 Protein (Fc Tag) 50μg 624 € adv human
RP-0298H Recombinant Human 2B4 / SLAMF / CD244 Protein (His Tag) 50μg 624 € adv human
CA63 Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His) 500 µg 1613 € novo human
abx250217 Anti-Human CD244/2B4 ELISA Kit inquire 50 € abbex human
BB-EK0926 anti-Human CD244/2B4 ELISA Kit Antibody 96 Tests 717 € acr human
MBS422588 Goat anti-phospho-CD244 / 2B4 Antibody 100ug 370 € MBS Polyclonals_1 human
AM05280PU-N anti-Natural Killer Cell Receptor-P1 Antibody 0,1 mg 587 € acr human
GENTAUR-58bdc07d57870 Mouse Anti-Human Natural killer cell p30-related protein Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc07dae095 Mouse Anti-Human Natural killer cell p30-related protein Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc07e2a1db Mouse Anti-Human Natural killer cell p44-related protein Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc07e80690 Mouse Anti-Human Natural killer cell p44-related protein Antibody 0.02 miligrams 277 € MBS mono human
GENTAUR-58bdc07ee716f Mouse Anti-Human Natural killer cell p44-related protein Antibody 100ug 608 € MBS mono human
abx257238 Anti-Human Natural Killer Cell ELISA Kit inquire 50 € abbex human
abx137429 Anti-Natural killer cell p30-related protein Antibody 5 µg 238 € abbex human
abx137428 Anti-Natural killer cell p44-related protein Antibody 100 µg 731 € abbex human
CC17 Recombinant Mouse Natural Cytotoxicity Triggering Receptor 1, NCR1(C-6His) 50 µg 303 € novo mouse
MBS613794 KLRK1 (Killer Cell Lectin-like Receptor Subfamily K Member 1, CD314, HGNC:18788, D12S2489E, NK Cell Receptor D, NK Lectin-like Receptor, NKLLR, NKG2D Activating NK Receptor, NKG2D Type II Integral Membrane Protein, NKR P2) 100ug 735 € MBS Polyclonals_1 human
MBS151248 SLAMF4 Antibody 100ug 431 € MBS Polyclonals_1 human
ZP-6253 SLAMF4 Peptide 0.05 mg 204 € Zyagen human
AE36453DO-96 Canine Natural killer cells antigen CD94 (KLRD1) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bd5ec70c8b6 Dog Natural killer cells antigen CD94 (KLRD1) 100ug 1492 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec75c3f3 Dog Natural killer cells antigen CD94 (KLRD1) 1000ug 1492 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec79edee Dog Natural killer cells antigen CD94 (KLRD1) 100ug 1995 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec7e6800 Dog Natural killer cells antigen CD94 (KLRD1) 1000ug 1995 € MBS Recombinant Proteins dog
AE36453DO-48 ELISA test for Canine Natural killer cells antigen CD94 (KLRD1) 1x plate of 48 wells 402 € abebio human