Recombinant Mouse SLAM, CD150 (C-6His)

Contact us
Catalog number: CS22
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Mouse SLAM, CD150 (C-6His)
Quantity: 0.1mg
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Signaling Lymphocytic Activation Molecule is produced by our Mammalian expression system and the target gene encoding Thr25-Pro242 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 25
UniProt number: Q9QUM4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD150 (C-6His), SLAM
Short name: CD150 (C-6His), Recombinant Mouse SLAM
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD150 (C-6His), recombinant Mouse SLAM
Alternative technique: rec
Identity: 10903
Gene: SLAMF1 | More about : SLAMF1
Long gene name: signaling lymphocytic activation molecule family member 1
Synonyms gene: SLAM
Synonyms gene name: signaling lymphocytic activation molecule
Synonyms: CD150
Locus: 1q23, 3
Discovery year: 1998-08-06
GenBank acession: U33017
Entrez gene record: 6504
Pubmed identfication: 7617038
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000024006

Related Products :

CS22 Recombinant Mouse SLAM, CD150 (C-6His) 10 µg 146 € novo mouse
C309 Recombinant Human Signaling Lymphocytic Activation Molecule, SLAM, CD150 (C-6His) 50 µg 263 € novo human
YSRTMCA2274A488 CD150, Signaling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse, ALEXA 488 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA2274A647 CD150, Signaling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse, ALEXA 647 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA2274XZ CD150, Signalling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse, azide-free; flow/functional assays 1 mg 973 € accurate-monoclonals mouse
YSRTMCA2274B CD150, Signalling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse, Biotin; flow 0.1 mg 177 € accurate-monoclonals mouse
YSRTMCA2274EL CD150, Signalling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse, endotoxin low; flow/functional assays 0.5 mg 604 € accurate-monoclonals mouse
YSRTMCA2274 CD150, Signalling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse; flow 0.1 mg 391 € accurate-monoclonals mouse
YSRTMCA2274GA CD150, Signalling Lymphocyte Activation Molecule (SLAM), 75kD, Clone: 9D1, Rat Mouse Monoclonal antibody-Mouse; flow 0.01 mg 205 € accurate-monoclonals mouse
RP-0265H Recombinant Human CD150 / SLAM / SLAMF1 Protein (His Tag) 50μg 624 € adv human
RP-2036R Recombinant Rat CD150 / SLAM / SLAMF1 Protein (His Tag) 50μg 624 € adv rat
MBS620004 BLAME (B-lymphocyte activator macrophage expressed, Lymphocyte Activator Macrophage Expressed, Slam family member 8, SLAM-8, SLAMF8) Antibody 100ug 564 € MBS Polyclonals_1 human
YSRTMCA2251XZ CD150, Signalling Lymphocytic Activation Molecule (SLAM), Clone: A12, Mouse Monoclonal antibody-Human, azide-free; flow/IP/functional studies (induces proliferation) 1 mg 1030 € accurate-monoclonals human
YSRTMCA2251B CD150, Signalling Lymphocytic Activation Molecule (SLAM), Clone: A12, Mouse Monoclonal antibody-Human, Biotin 0.1 mg 447 € accurate-monoclonals human
YSRTMCA2251F CD150, Signalling Lymphocytic Activation Molecule (SLAM), Clone: A12, Mouse Monoclonal antibody-Human, FITC 0.1 mg 404 € accurate-monoclonals human
YSRTMCA2251 CD150, Signalling Lymphocytic Activation Molecule (SLAM), Clone: A12, Mouse Monoclonal antibody-Human; flow/IP 200ug 462 € accurate-monoclonals human
YSRTMCA2251GA CD150, Signalling Lymphocytic Activation Molecule (SLAM), Clone: A12, Mouse Monoclonal antibody-Human; flow/IP 0.1 mg 233 € accurate-monoclonals human
abx218601 Anti-SLAM/CD150 (pT281) Antibody 100 μg 311 € abbex human
CS51 Recombinant Mouse SLAM Family Member 2, CD48(C-6His) 500 µg 1613 € novo mouse
CK72 Recombinant Mouse SLAM Family Member 5, SLAMF5, CD84(C-6His) 10 µg 146 € novo mouse
CS62 Recombinant Mouse SLAM Family Member 7, CRACC, SLAM7, CD319 (C-6His) 1 mg 1674 € novo mouse
CS65 Recombinant Mouse SLAM Family Member 8, SLAMF8 (C-6His) 10 µg 141 € novo mouse
C789 Recombinant Mouse SLAM Family Member 9, SLAMF9, CD2F-10 (C-6His) 500 µg 1613 € novo mouse
CB90 Recombinant Human SLAM Family Member 2, CD48 (C-Fc-6His) 10 µg 146 € novo human
CS60 Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His) 1 mg 1674 € novo human
C387 Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-6His) 10 µg 121 € novo human
C316 Recombinant Human SLAM Family Member 7, SLAMF7, CD319, CRACC (C-6His) 500 µg 1613 € novo human
C771 Recombinant Human SLAM Family Member 8, BLAME, SLAMF8, BLAME (C-6His) 500 µg 1613 € novo human
CP81 Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-Fc) 10 µg 141 € novo human
TNB059A CDw150, SLAM, Clone: IPO-3, Mouse Monoclonal antibody-Human; Human; ELISA 0.1mg Ask price € accurate-monoclonals human