Recombinant Mouse CD27, TNFRSF7 (C-Fc-6His)

Contact us
Catalog number: CP48
Price: 412 €
Supplier: abbex
Product name: Recombinant Mouse CD27, TNFRSF7 (C-Fc-6His)
Quantity: 10 μg
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 659€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Mouse CD27 antigen is produced by our expression system and the target gene encoding Pro24-Arg182 is expressed with a Fc
Molecular Weight: 45, 8 kD
UniProt number: P41272
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TNFRSF7 (C-Fc-6His), CD27
Short name: TNFRSF7 (C-Fc-6His), Recombinant Mouse CD27
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TNFRSF7 (C-fragment c-6His), recombinant Mouse CD27 molecule
Alternative technique: rec
Alternative to gene target: CD27 and IDBG-14014 and ENSG00000139193 and 939, CD27 and IDBG-640494 and ENSBTAG00000014725 and 512514, Cd27 and IDBG-189750 and ENSMUSG00000030336 and 21940, Extracellular, LPFS2 and T14 and TNFRSF7 and Tp55, S152 and S152, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016064 and immunoglobulin mediated immune response and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045579 and positive regulation of B cell differentiation and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070233 and negative regulation of T cell apoptotic process and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, CD27 molecule
Identity: 11922
Gene: CD27 | More about : CD27
Long gene name: CD27 molecule
Synonyms gene: TNFRSF7
Synonyms gene name: member 7 , tumor necrosis factor receptor superfamily
Synonyms: S152 Tp55
Locus: 12p13, 31
Discovery year: 1992-06-10
GenBank acession: M63928
Entrez gene record: 939
Pubmed identfication: 2442250 8530100
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000168316
Locus Specific Databases: LRG_357

Related Products :

CP48 Recombinant Mouse CD27, TNFRSF7 (C-Fc-6His) 500 µg 659 € novo mouse
CD60 Recombinant Human CD27, TNFRSF7 (C-Fc-6His) 1 mg 1166 € novo human
RP-1115M Recombinant Mouse CD27 / TNFRSF7 Protein (His Tag) 50μg 624 € adv mouse
RP-0301H Recombinant Human CD27 / TNFRSF7 Protein (Fc Tag) 100μg 624 € adv human
RP-0302H Recombinant Human CD27 / TNFRSF7 Protein (His & Fc Tag) 100μg 624 € adv human
RP-1038RC Recombinant Rhesus CD27 / TNFRSF7 Protein (Fc Tag) 50μg 456 € adv rhesus
GENTAUR-58be60b4549a2 Anti-CD27/TNFRSF7 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx250219 Anti-Human CD27/TNFRSF7 ELISA Kit inquire 50 € abbex human
bs-2491R-A350 CD27/TNFRSF7 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2491R-A488 CD27/TNFRSF7 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2491R-A555 CD27/TNFRSF7 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2491R-A594 CD27/TNFRSF7 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2491R-A647 CD27/TNFRSF7 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2491R-Biotin CD27/TNFRSF7 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2491R CD27/TNFRSF7 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-2491R-Cy3 CD27/TNFRSF7 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2491R-Cy5 CD27/TNFRSF7 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2491R-Cy5.5 CD27/TNFRSF7 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2491R-Cy7 CD27/TNFRSF7 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2491R-FITC CD27/TNFRSF7 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2491R-HRP CD27/TNFRSF7 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
103-M486 Anti-Mouse TNFRSF7 100ug 336 € Reliatech antibodies mouse
101-M667 Anti-Human TNFRSF7 100ug 336 € Reliatech antibodies human
GENTAUR-58bdcd553bda2 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcd55a7daf Anti- Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcdff880c4 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddb778e7f9 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7) Antibody 100ug 542 € MBS Polyclonals human
EKU08307 Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
YSRTMCA4701 CD27, Hamster Mouse Monoclonal antibody-Mouse; Clone: LG.3A10, frozen,flow,IP 0.25 mg 391 € accurate-monoclonals mouse
abx165913 Anti-CD27 Binding Protein (Recombinant) 10 μg 412 € abbex human