| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Ala37-Asp161 is expressed fused with a 6His tag at the C-terminus |
| Molecular Weight: |
14, 6 kD |
| UniProt number: |
P09793 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD152 (C-6His), CTLA-4, Cytotoxic T-Lymphocyte Protein 4 |
| Short name: |
CD152 (C-6His), CTLA-4, Recombinant Mouse Cytotoxic T-Lymphocyte Protein 4 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD152 (C-6His), CTLA-4, recombinant Mouse Cytotoxic T-Lymphocyte Protein 4 |
| Alternative technique: |
rec |
| Identity: |
2505 |
| Gene: |
CTLA4 |
More about : CTLA4 |
| Long gene name: |
cytotoxic T-lymphocyte associated protein 4 |
| Synonyms gene: |
CELIAC3 IDDM12 |
| Synonyms gene name: |
celiac disease 3 insulin-dependent diabetes mellitus 12 |
| Synonyms: |
CD152 CD GSE |
| Locus: |
2q33, 2 |
| Discovery year: |
1989-05-25 |
| Entrez gene record: |
1493 |
| Pubmed identfication: |
3220103 8817351 |
| RefSeq identity: |
NM_005214 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000132877 |