Recombinant Mouse S100 Calcium Binding Protein A15A, S100A15A

Contact us
Catalog number: CP24
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse S100 Calcium Binding Protein A15A, S100A15A
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse S100 calcium binding protein A15A is produced by our E, coli expression system and the target gene encoding Met1-Tyr108 is expressed
Molecular Weight: 12, 9 kD
UniProt number: Q6S5I3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: S100A15A, S100 Calcium Binding Protein A15A
Short name: S100A15A, Recombinant Mouse S100 Calcium Binding Protein A15A
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: S100A15A, recombinant Mouse S100 Calcium Binding Protein A15A
Alternative technique: rec

Related Products :

CP24 Recombinant Mouse S100 Calcium Binding Protein A15A, S100A15A 10 µg 146 € novo mouse
GENTAUR-58ba592b59ddb Gorilla gorilla gorilla Protein S100-A15A (S100A15A) 100ug 1387 € MBS Recombinant Proteins human
GENTAUR-58ba592c14e68 Gorilla gorilla gorilla Protein S100-A15A (S100A15A) 1000ug 1387 € MBS Recombinant Proteins human
GENTAUR-58ba592cab420 Gorilla gorilla gorilla Protein S100-A15A (S100A15A) 100ug 1890 € MBS Recombinant Proteins human
GENTAUR-58ba592d2bfa9 Gorilla gorilla gorilla Protein S100-A15A (S100A15A) 1000ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bcac7aee2ea Pongo abelii Protein S100-A15A (S100A15A) 100ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bcac7b47d06 Pongo abelii Protein S100-A15A (S100A15A) 1000ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bcac7b8f08a Pongo abelii Protein S100-A15A (S100A15A) 100ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bcac7bd86fb Pongo abelii Protein S100-A15A (S100A15A) 1000ug 1890 € MBS Recombinant Proteins human
MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
C258 Recombinant Human S100 Calcium Binding Protein P, S100-P (N-6His) 50 µg 496 € novo human
DL-S100-Mu Mouse S100 Calcium Binding Protein S100 ELISA Kit 96T 869 € DL elisas mouse
MBS623290 S100 Calcium Binding Protein A12 (S100A12, CAAF1, Calcium-binding Protein in Amniotic Fluid, Calgranulin-C, CAGC, Calgranulin Related Protein, CGRP, EN-RAGE, ENRAGE, Extracellular Newly Identified RAGE-binding Protein, Neutrophil S100 Protein, p6) 100ul 597 € MBS Polyclonals_1 human
MBS619446 ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1, CRACM1, FLJ14466, ORAT1, TMEM142A, calcium release-activated calcium channel protein 1, Transmembrane protein 142A) Antibody 100ug 591 € MBS Polyclonals_1 human
abx576375 Anti-Cow S100 Calcium Binding Protein (S100) ELISA Kit 96 tests 833 € abbex cow
MBS280005 Anti-Human S100 Calcium Binding Protein (S100) PAb 100ug 520 € MBS Polyclonals_1 human
abx573893 Anti-Rat S100 Calcium Binding Protein (S100) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc70c34539 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc70c87593 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc89941793 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc9a524974 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdca0060279 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca00b1b60 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcad4a4f91 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdce44c50dc Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdce4535049 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf6a53607 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 348 € MBS Polyclonals human
GENTAUR-58bdcf6aaf0ff Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcf9f1f8c9 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd9d68f868 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human