Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His)

Contact us
Catalog number: CM92
Price: 486 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse TREM-2b is produced by our Mammalian expression system and the target gene encoding Leu19-Pro168 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 3 kD
UniProt number: Q99NH8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TREM-2b (C-6His), Triggering Receptor Expressed on Myeloid Cells 2b
Short name: TREM-2b (C-6His), Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TREM-2b (C-6His), recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b
Alternative technique: rec

Related Products :

MBS620836 TREM-1 (Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1 precursor) 1 mililiter 713 € MBS Polyclonals_1 human
CM92 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His) 50 µg 303 € novo mouse
CM91 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-Fc) 1 mg 2283 € novo mouse
C807 Recombinant Human Triggering Receptor Expressed On Myeloid 2, TREM-2 (C-6His) 50 µg 303 € novo human
abx166282 Anti-Triggering Receptor Expressed On Myeloid Cells 1 Protein (Recombinant) 100 μg 905 € abbex human
abx262303 Anti-Triggering Receptor Expressed on Myeloid Cells 1 Protein (Recombinant) 1 mg 6169 € abbex human
abx167352 Anti-Triggering Receptor Expressed On Myeloid Cells 2 Protein (Recombinant) 10 μg 412 € abbex human
abx167723 Anti-Triggering Receptor Expressed On Myeloid Cells 2 Protein (Recombinant) 100 μg 905 € abbex human
abx262727 Anti-Triggering Receptor Expressed on Myeloid Cells 2 Protein (Recombinant) 2 µg 238 € abbex human
GENTAUR-58bdc0aeb2f39 Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc0af0dcac Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc0af512f4 Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 0.02 miligrams 277 € MBS mono human
DL-TREM1-Mu Mouse Triggering Receptor Expressed On Myeloid Cells 1 TREM1 ELISA Kit 96T 672 € DL elisas mouse
DL-TREM2-Mu Mouse Triggering Receptor Expressed On Myeloid Cells 2 TREM2 ELISA Kit 96T 921 € DL elisas mouse
abx253226 Anti-Human soluble Triggering Receptor Expressed on Myeloid Cells-1 ELISA Kit 96 tests 557 € abbex human
abx190092 Anti-Human Triggering Receptor Expressed On Myeloid Cells 1 CLIA Kit inquire 50 € abbex human
abx253495 Anti-Human Triggering receptor expressed on myeloid cells 1 ELISA Kit inquire 50 € abbex human
abx250733 Anti-Human Triggering receptor expressed on myeloid cells 2 ELISA Kit inquire 50 € abbex human
GENTAUR-58bdca3272e01 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca32c80f1 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb5bd4692 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcb5c53901 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 354 € MBS Polyclonals human
GENTAUR-58bdd2a044cce Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd35c5aebb Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd583709eb Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd6d6bb651 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bdd97f28423 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd98b91cb5 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd98c08cdd Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bddade89a3d Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 486 € MBS Polyclonals human