Recombinant Mouse Mannose Binding Lectin 2, MBL-2, MBP-C

Contact us
Catalog number: CM90
Price: 783 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Mouse Mannose Binding Lectin 2, MBL-2, MBP-C
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Mannose Binding Lectin 2 is produced by our Mammalian expression system and the target gene encoding Glu19-Asp244 is expressed
Molecular Weight: 24 kD
UniProt number: Q3UEK1
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: MBL-2, MBP-C, Mannose Binding Lectin 2
Short name: MBL-2, MBP-C, Recombinant Mouse Mannose Binding Lectin 2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: MBL-2, MBP-C, recombinant Mouse Mannose Binding Lectin 2
Alternative technique: rec

Related Products :

E-EL-Ch0630 Chicken MBP/MBL (Mannose Binding Protein/Mannose Binding Lectin) ELISA Kit 96T 568 € elabsciences chicken
CM90 Recombinant Mouse Mannose Binding Lectin 2, MBL-2, MBP-C 1 mg 2283 € novo mouse
MBS615338 Mannan Binding Lectin 1 (MBL-1, MBL1, Mannose Binding Lectin 1A) Antibody 100ug 774 € MBS Polyclonals_1 human
C488 Recombinant Human Mannose-Binding Protein C, MBL-2, MBP- C(C-6His) 1 mg 2283 € novo human
MBS619555 Galectin-1 (GAL1, LGALS1, GAL-1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, 14kD lectin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620576 Galectin-1 (GAL1, LGALS1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) (Biotin) Antibody 50ug 597 € MBS Polyclonals_1 human
EKC01121 Mannma binding protein/mannan binding lectin (MBP/MBL) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
MBS613615 Lectin, Mannose-binding 1 (LMAN1, Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 53, Intracellular Mannose Specific Lectin) 50ug 625 € MBS Polyclonals_1 human
abx570432 Anti-Mouse Mannose Binding Lectin (MBL) ELISA Kit inquire 50 € abbex mouse
DL-MBL-Mu Mouse Mannose Binding Lectin MBL ELISA Kit 96T 904 € DL elisas mouse
abx574021 Anti-Chicken Mannose Binding Lectin (MBL) ELISA Kit inquire 50 € abbex chicken
abx570202 Anti-Human Mannose Binding Lectin (MBL) ELISA Kit inquire 50 € abbex human
EKU02455 Anti-Mannose Binding Lectin Antibody (Anti-MBL) ELISA kit 1 plate of 96 wells 1150 € Biomatik ELISA kits human
GENTAUR-58bdc35556098 Anti- Mannose Binding Lectin (MBL) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc355b3c23 Anti- Mannose Binding Lectin (MBL) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc382608e3 Anti- Mannose Binding Lectin (MBL) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc75fea242 Anti- Mannose Binding Lectin (MBL) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc7605bc31 Anti- Mannose Binding Lectin (MBL) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdca4d3cb8d Anti- Mannose Binding Lectin (MBL) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdcbbc589d6 Anti- Mannose Binding Lectin (MBL) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcbbcc003c Anti- Mannose Binding Lectin (MBL) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd37cd3bb8 Anti- Mannose Binding Lectin (MBL) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd3d2bcc3f Anti- Mannose Binding Lectin (MBL) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd5fa55896 Anti- Mannose Binding Lectin (MBL) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd6587c89c Anti- Mannose Binding Lectin (MBL) Antibody 100ug 575 € MBS Polyclonals human
abx574032 Anti-Rat Mannose Binding Lectin (MBL) ELISA Kit 96 tests 804 € abbex rat
DL-MBL-Ch Chicken Mannose Binding Lectin MBL ELISA Kit 96T 962 € DL elisas chicken
DL-MBL-Hu Human Mannose Binding Lectin MBL ELISA Kit 96T 869 € DL elisas human
EKU05788 Mannose Binding Lectin (MBL) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
EKU05789 Mannose Binding Lectin (MBL) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human