Recombinant Mouse Frizzled 1, FZD1 (C-Fc)

Contact us
Catalog number: CM61
Price: 369 €
Supplier: abbex
Product name: Recombinant Mouse Frizzled 1, FZD1 (C-Fc)
Quantity: 200 μg
Other quantities: 1 mg 1877€ 10 µg 126€ 50 µg 232€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Frizzled 1 is produced by our Mammalian expression system and the target gene encoding Val69-His248 is expressed with a Fc tag at the C-terminus
Molecular Weight: 46, 8 kD
UniProt number: O70421
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: FZD1 (C-Fc), Frizzled 1
Short name: FZD1 (C-Fc), Recombinant Mouse Frizzled 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: FZD1 (C-fragment c), recombinant Mouse Frizzled 1
Alternative technique: rec
Identity: 4038
Gene: FZD1 | More about : FZD1
Long gene name: frizzled class receptor 1
Synonyms gene name: frizzled (Drosophila) homolog 1 frizzled homolog 1 (Drosophila) frizzled 1, seven transmembrane spanning receptor frizzled family receptor 1
Synonyms: DKFZp564G072
Synonyms name: 1 , Drosophila, Wnt receptor frizzled, homolog of
Locus: 7q21, 13
Discovery year: 1998-09-17
GenBank acession: AB017363
Entrez gene record: 8321
Pubmed identfication: 9813155
RefSeq identity: NM_003505
Classification: Class F frizzled , G protein-coupled receptors
Havana BLAST/BLAT: OTTHUMG00000023046

Related Products :

MBS611058 Fz5 (FZD5, Frizzled Homolog 5 (Drosophila), C2orf31, Chromosome 2 Open Reading Frame 31, DKFZp434E2135, DKFZP434E2135, Frizzled-5, Frizzled 5 precursor, Frizzled-5 precursor, Fz-5, FzE5, hFz5, Hfz5, HFZ5, MGC129692, Uncharacterized Protein C2orf31) Antibody 200ug 614 € MBS Polyclonals_1 drosophila
CM61 Recombinant Mouse Frizzled 1, FZD1 (C-Fc) 1 mg 1877 € novo mouse
RP-1299M Recombinant Mouse Frizzled-1 / FZD1 Protein (His Tag) 50μg 624 € adv mouse
GENTAUR-58ba3dfe9e222 Mouse Frizzled-1 (Fzd1) 1000ug 2514 € MBS Recombinant Proteins mouse
GENTAUR-58ba3dff0c1ea Mouse Frizzled-1 (Fzd1) 1000ug 3022 € MBS Recombinant Proteins mouse
GENTAUR-58bdcaf0187bb Anti- Frizzled Homolog 1 (FZD1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcaf08616a Anti- Frizzled Homolog 1 (FZD1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd27688b19 Anti- Frizzled Homolog 1 (FZD1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd6c48985f Anti- Frizzled Homolog 1 (FZD1) Antibody 100ug 564 € MBS Polyclonals human
AP01203PU-N anti-FZD1 / Frizzled-1 Antibody 0,1 mg 558 € acr human
AP12393PU-N anti-FZD1 / Frizzled-1 (C-term) Antibody 0,4 ml 587 € acr human
abx571378 Anti-Human Frizzled Homolog 1 (FZD1) ELISA Kit inquire 50 € abbex human
MBS247107 Anti-Human FZD1 / Frizzled 1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS247979 Anti-Human FZD1 / Frizzled 1 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bcfee10f150 Chicken Frizzled-1 (FZD1) 1000ug 2442 € MBS Recombinant Proteins chicken
GENTAUR-58bcfee160cfc Chicken Frizzled-1 (FZD1) 1000ug 2945 € MBS Recombinant Proteins chicken
R32354 Frizzled 1 Antibody / FZD1 0.1mg 406 € NJS poly human
EKU04276 Frizzled Homolog 1 (FZD1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS624090 FZD1, CT (Frizzled-1, Fz-1, hFz1, FzE1) Antibody 200ul 603 € MBS Polyclonals_1 human
DL-FZD1-Hu Human Frizzled Homolog 1 FZD1 ELISA Kit 96T 904 € DL elisas human
A01F0114 anti-FZD1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bde99458848 Anti- FZD1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde994b4ff1 Anti- FZD1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf913b72dd Anti- FZD1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf91433cbd Anti- FZD1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be03c73e4ad Anti- FZD1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be03c7f2a9d Anti- FZD1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be077a59e14 Anti- FZD1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be077abd9ae Anti- FZD1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx147389 Anti-FZD1 Antibody 200 μg 369 € abbex human