Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His)

Contact us
Catalog number: CM49
Price: 575 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 126€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 19 kD
UniProt number: Q9QYY7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: ESM-1 (C-6His), Endothelial Specific Molecule Endocan
Short name: ESM-1 (C-6His), Recombinant Mouse Endothelial Cell-Specific Molecule Endocan
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: ESM-1 (C-6His), Endocan, recombinant Mouse Endothelial cellular-Specific Molecule
Alternative technique: rec

Related Products :

CM49 Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His) 10 µg 126 € novo mouse
C338 Recombinant Human Endocan, ESM-1 (C-6His) 500 µg 1613 € novo human
103-M221 Anti-Mouse Endocan/ESM-1 100ug 336 € Reliatech antibodies mouse
102-PA44 Anti-Human Endocan/ESM-1 200ug 271 € Reliatech antibodies human
C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
RP-1276M Recombinant Mouse ESM1 / Endocan Protein (His Tag) 20μg 346 € adv mouse
abx261000 Anti-Endothelial Cell-Specific Molecule 1 Protein (Recombinant) 1 mg 3559 € abbex human
ICCMES140 Epithelial Sialomucin (ESM), Clone:140C1, Mouse Monoclonal antibody- 1000ul 465 € accurate-monoclonals mouse
RP-0663H Recombinant Human ESM1 / Endocan Protein (His Tag) 20μg 572 € adv human
abx254028 Anti-Mouse Endothelial Cell Specific Molecule 1 ELISA Kit inquire 50 € abbex mouse
MBS622250 Endothelial Monocyte Activating Polypeptide II (EMAP II, EMAPII, Endothelial Monocyte Activating Polypeptide 2, EMAP 2, EMAP2, AIMP1, Endothelial Monocyte Activating Polypeptide, Multisynthetase Complex Auxiliary Component p43, p43, Small Inducible Cytoki Antibody 100ug 630 € MBS Polyclonals_1 human
RP-1275M Recombinant Mouse ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv mouse
CEK1457 anti-Mouse Endocan ELISA Kit Antibody 96 Tests 703 € acr mouse
GENTAUR-58bdc3c4ca3e8 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc3c547ab4 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc94403214 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc9443e4cc Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcca370f25 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdce076ceca Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdce07e56d8 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdce32518bb Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdce6359797 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdce63c4ee0 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd3c528d95 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd3ce28ce1 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd750995fa Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd7b79da6b Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd9d0a8920 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdda61488c2 Anti- Endothelial Cell Specific Molecule 1 (ESM1) Antibody 100ug 575 € MBS Polyclonals human