Recombinant Mouse Nephroblastoma Overexpressed Gene , NOV, CCN3, IGFBP-9 (C-6His)

Contact us
Catalog number: CM47
Price: 1254 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Nephroblastoma Overexpressed Gene , NOV, CCN3, IGFBP-9 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1877€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse CCN3 is produced by our Mammalian expression system and the target gene encoding Ser26-Ile354 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 39
UniProt number: Q64299
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CCN3, IGFBP-9 (C-6His), Nephroblastoma Overexpressed Gene NOV
Short name: CCN3, IGFBP-9 (C-6His), Recombinant Mouse Nephroblastoma Overexpressed Gene NOV
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CCN3, IGFBP-9 (C-6His), NOV, recombinant Mouse Nephroblastoma Overexpressed Gene
Alternative technique: rec
Identity: 7885
Gene: NOV | More about : NOV
Long gene name: nephroblastoma overexpressed
Synonyms gene name: nephroblastoma overexpressed gene
Synonyms: IGFBP9 CCN3
Locus: 8q24, 12
Discovery year: 1993-11-05
GenBank acession: X96584
Entrez gene record: 4856
Pubmed identfication: 1334251
RefSeq identity: NM_002514
Classification: CYR61/CTGF/NOV matricellular proteins
Havana BLAST/BLAT: OTTHUMG00000164984

Related Products :

CM47 Recombinant Mouse Nephroblastoma Overexpressed Gene , NOV, CCN3, IGFBP-9 (C-6His) 500 µg 1328 € novo mouse
GWB-E47157 Nephroblastoma Overexpressed Gene (NOV) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
abx167274 Anti-Nephroblastoma Overexpressed Gene Protein (Recombinant) 50 μg 601 € abbex human
abx167777 Anti-Nephroblastoma Overexpressed Gene Protein (Recombinant) 100 μg 920 € abbex human
abx129784 Anti-Nephroblastoma Overexpressed Gene Antibody 10 μg 282 € abbex human
abx130360 Anti-Nephroblastoma Overexpressed Gene Antibody 10 μg 282 € abbex human
GENTAUR-58bde6d134a22 Mouse Monoclonal [clone 2G8] (IgG2a,k) to Human CCN3 / NOV Antibody 50ug 663 € MBS mono human
MBS241722 Anti-Human CCN3 / NOV 50ug 597 € MBS Polyclonals_1 human
abx261807 Anti-Nephroblastoma Overexpressed Protein (Recombinant) 20 µg 340 € abbex human
abx261834 Anti-Nephroblastoma Overexpressed Protein (Recombinant) 1 mg 4559 € abbex human
AE30662CH Chicken Protein NOV homolog (NOV) ELISA Kit 96 wells plate 810 € ab-elisa elisas chicken
AE30662CH-96 Chicken Protein NOV homolog (NOV) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
GENTAUR-58b89ae714972 Coturnix coturnix japonica Protein NOV (NOV) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58b89ae788086 Coturnix coturnix japonica Protein NOV (NOV) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58b89ae7dd50b Coturnix coturnix japonica Protein NOV (NOV) 100ug 2453 € MBS Recombinant Proteins human
GENTAUR-58b89ae84d2e2 Coturnix coturnix japonica Protein NOV (NOV) 1000ug 2453 € MBS Recombinant Proteins human
AE30662CH-48 ELISA test for Chicken Protein NOV homolog (NOV) 1x plate of 48 wells 402 € abebio chicken
GENTAUR-58bd539551a4d Xenopus laevis Protein NOV homolog (nov) 100ug 1934 € MBS Recombinant Proteins xenopus
GENTAUR-58bd5395a5ef0 Xenopus laevis Protein NOV homolog (nov) 1000ug 1934 € MBS Recombinant Proteins xenopus
GENTAUR-58bd5395f1035 Xenopus laevis Protein NOV homolog (nov) 100ug 2448 € MBS Recombinant Proteins xenopus
GENTAUR-58bd539634a61 Xenopus laevis Protein NOV homolog (nov) 1000ug 2448 € MBS Recombinant Proteins xenopus
MBS616690 Insulin-Like Growth Factor Binding Protein-Like 1 (IGFBP-L1, IGFBP-rP4) Antibody 100ug 774 € MBS Polyclonals_1 human
CK73 Recombinant Mouse IGF Binding Protein 6, IGFBP-6 (C-6His) 10 µg 156 € novo mouse
C347 Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His) 10 µg 168 € novo human
CA41 Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His) 10 µg 202 € novo human
GENTAUR-58bd4bfb809e5 Bovine Prostate tumor-overexpressed gene 1 protein homolog (PTOV1) 100ug 2166 € MBS Recombinant Proteins bovine
GENTAUR-58bd4bfbb7aaf Bovine Prostate tumor-overexpressed gene 1 protein homolog (PTOV1) 1000ug 2166 € MBS Recombinant Proteins bovine
GENTAUR-58bd4bfc291bc Bovine Prostate tumor-overexpressed gene 1 protein homolog (PTOV1) 100ug 2680 € MBS Recombinant Proteins bovine
GENTAUR-58bd4bfc7a3e3 Bovine Prostate tumor-overexpressed gene 1 protein homolog (PTOV1) 1000ug 2680 € MBS Recombinant Proteins bovine
GENTAUR-58b8f12b9d179 Xenopus laevis Myeloma-overexpressed gene 2 protein homolog (myeov2) 100ug 1254 € MBS Recombinant Proteins xenopus