Recombinant Mouse Ectodysplasin A2 Receptor, EDA2R, TNFRSF27 (C-6His)

Contact us
Catalog number: CM44
Price: 126 €
Supplier: novo
Product name: Recombinant Mouse Ectodysplasin A2 Receptor, EDA2R, TNFRSF27 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 1877€ 10 µg 126€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Ectodysplasin A2 Receptor is produced by our Mammalian expression system and the target gene encoding Met1-Thr138 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 4 kD
UniProt number: Q8BX35
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRAQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: EDA2R, TNFRSF27 (C-6His), Ectodysplasin A2 Receptor
Short name: EDA2R, TNFRSF27 (C-6His), Recombinant Mouse Ectodysplasin A2 Receptor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TNFRSF27 (C-6His), ectodysplasin A2 receptor, recombinant Mouse Ectodysplasin A2 Receptor
Alternative technique: rec
Alternative to gene target: EDA2R and IDBG-636425 and ENSBTAG00000047326 and 100301324, EDA2R and IDBG-73673 and ENSG00000131080 and 60401, Eda2r and IDBG-161374 and ENSMUSG00000034457 and 245527, Plasma membranes, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0008544 and epidermis development and biological process this GO :0009790 and embryo development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030154 and cell differentiation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, ectodysplasin A2 receptor
Identity: 17756
Gene: EDA2R | More about : EDA2R
Long gene name: ectodysplasin A2 receptor
Synonyms: XEDAR EDA-A2R EDAA2R TNFRSF27
Locus: Xq12
Discovery year: 2004-08-17
GenBank acession: AF298812
Entrez gene record: 60401
Pubmed identfication: 11039935
RefSeq identity: NM_021783
Classification: Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000021736
Locus Specific Databases: Mental Retardation database

Related Products :

CM44 Recombinant Mouse Ectodysplasin A2 Receptor, EDA2R, TNFRSF27 (C-6His) 10 µg 126 € novo mouse
CM43 Recombinant Mouse Ectodysplasin A2 Receptor, EDA2R, TNFRSF27 (C-Fc) 50 µg 232 € novo mouse
AR51218PU-N anti-EDA2R / TNFRSF27 (1-138, His-tag) Antibody 0,5 mg 1109 € acr human
AR51218PU-S anti-EDA2R / TNFRSF27 (1-138, His-tag) Antibody 0,1 mg 485 € acr human
AP05597PU-N anti-EDA2R / TNFRSF27 Antibody 0,1 mg 514 € acr human
AP05597PU-S anti-EDA2R / TNFRSF27 Antibody 50 Вµg 456 € acr human
AP07746PU-N anti-EDA2R / TNFRSF27 Antibody 50 Вµg 732 € acr human
EKU08482 Ectodysplasin A2 Receptor (EDA2R) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
CK76 Recombinant Mouse Ectodysplasin Receptor, EDAR (C-Fc) 10 µg 146 € novo mouse
abx261191 Anti-Ectodysplasin A2 Receptor Protein (Recombinant) 1 mg 3559 € abbex human
abx156835 Anti-Human Ectodysplasin A2 Receptor ELISA Kit 96 tests 934 € abbex human
abx255053 Anti-Mouse Ectodysplasin-A ELISA Kit 96 tests 659 € abbex mouse
GENTAUR-58ba70abed5df Mouse Ectodysplasin-A (Eda) 100ug 1945 € MBS Recombinant Proteins mouse
GENTAUR-58ba70ac5025d Mouse Ectodysplasin-A (Eda) 1000ug 1945 € MBS Recombinant Proteins mouse
GENTAUR-58ba70aca7de7 Mouse Ectodysplasin-A (Eda) 100ug 2459 € MBS Recombinant Proteins mouse
GENTAUR-58ba70ad0897e Mouse Ectodysplasin-A (Eda) 1000ug 2459 € MBS Recombinant Proteins mouse
RP-1601M Recombinant Mouse XEDAR / EDA2R Protein (Fc Tag) 50μg 624 € adv mouse
BB-PA1561 anti-Ectodysplasin-A Antibody 0,1 mg 471 € acr human
GENTAUR-58bdc82e78962 Anti- Ectodysplasin A (EDA) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc82f0409e Anti- Ectodysplasin A (EDA) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd280950da Anti- Ectodysplasin A (EDA) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddbcd24fa0 Anti- Ectodysplasin A (EDA) Antibody 100ug 575 € MBS Polyclonals human
AP13273PU-N anti-Ectodysplasin-A (N-term) Antibody 0,4 ml 587 € acr human
abx251354 Anti-Human Ectodysplasin-A ELISA Kit inquire 50 € abbex human
RP-1074RC Recombinant Cynomolgus XEDAR / EDA2R Protein (Fc Tag) 50μg 624 € adv human
RP-1649H Recombinant Human XEDAR / EDA2R Protein (His Tag) 50μg 624 € adv human
RP-2273R Recombinant Rat XEDAR / EDA2R Protein (Fc Tag) 50μg 624 € adv rat
RP-2274R Recombinant Rat XEDAR / EDA2R Protein (His Tag) 50μg 624 € adv rat
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse