| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Ectodysplasin A2 Receptor is produced by our Mammalian expression system and the target gene encoding Met1-Thr138 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
16, 4 kD |
| UniProt number: |
Q8BX35 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRAQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
EDA2R, TNFRSF27 (C-6His), Ectodysplasin A2 Receptor |
| Short name: |
EDA2R, TNFRSF27 (C-6His), Recombinant Mouse Ectodysplasin A2 Receptor |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
TNFRSF27 (C-6His), ectodysplasin A2 receptor, recombinant Mouse Ectodysplasin A2 Receptor |
| Alternative technique: |
rec |
| Alternative to gene target: |
EDA2R and IDBG-636425 and ENSBTAG00000047326 and 100301324, EDA2R and IDBG-73673 and ENSG00000131080 and 60401, Eda2r and IDBG-161374 and ENSMUSG00000034457 and 245527, Plasma membranes, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0008544 and epidermis development and biological process this GO :0009790 and embryo development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030154 and cell differentiation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, ectodysplasin A2 receptor |
| Identity: |
17756 |
| Gene: |
EDA2R |
More about : EDA2R |
| Long gene name: |
ectodysplasin A2 receptor |
| Synonyms: |
XEDAR EDA-A2R EDAA2R TNFRSF27 |
| Locus: |
Xq12 |
| Discovery year: |
2004-08-17 |
| GenBank acession: |
AF298812 |
| Entrez gene record: |
60401 |
| Pubmed identfication: |
11039935 |
| RefSeq identity: |
NM_021783 |
| Classification: |
Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000021736 |
| Locus Specific Databases: |
Mental Retardation database |