Recombinant Mouse Frizzled 2, FZD2 (C-Fc)

Contact us
Catalog number: CM12
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Mouse Frizzled 2, FZD2 (C-Fc)
Quantity: bulk
Other quantities: 1 mg 1877€ 10 µg 126€ 50 µg 232€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Frizzled 2 is produced by our Mammalian expression system and the target gene encoding Gln29-Leu168 is expressed with a Fc tag at the C-terminus
Molecular Weight: 42, 9 kD
UniProt number: Q9JIP6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: FZD2 (C-Fc), Frizzled 2
Short name: FZD2 (C-Fc), Recombinant Mouse Frizzled 2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: FZD2 (C-fragment c), recombinant Mouse Frizzled 2
Alternative technique: rec
Identity: 4040
Gene: FZD2 | More about : FZD2
Long gene name: frizzled class receptor 2
Synonyms gene name: frizzled (Drosophila) homolog 2 frizzled homolog 2 (Drosophila) frizzled 2, seven transmembrane spanning receptor frizzled family receptor 2
Locus: 17q21, 31
Discovery year: 1995-07-18
GenBank acession: L37882
Entrez gene record: 2535
Pubmed identfication: 7558010 9813155
RefSeq identity: NM_001466
Classification: Class F frizzled , G protein-coupled receptors
Havana BLAST/BLAT: OTTHUMG00000181819

Related Products :

MBS611058 Fz5 (FZD5, Frizzled Homolog 5 (Drosophila), C2orf31, Chromosome 2 Open Reading Frame 31, DKFZp434E2135, DKFZP434E2135, Frizzled-5, Frizzled 5 precursor, Frizzled-5 precursor, Fz-5, FzE5, hFz5, Hfz5, HFZ5, MGC129692, Uncharacterized Protein C2orf31) Antibody 200ug 614 € MBS Polyclonals_1 drosophila
CM12 Recombinant Mouse Frizzled 2, FZD2 (C-Fc) 50 µg 232 € novo mouse
RP-1810H Recombinant Human FZD2 /Frizzled-2 Protein, with Fc Tag 100ug 688 € adv human
AP01425PU-N anti-FZD2 / Frizzled-2 Antibody 0,1 mg 558 € acr human
AP22449PU-N anti-FZD2 / Frizzled-2 Antibody 0,1 mg 558 € acr human
AP23061PU-N anti-FZD2 / Frizzled-2 Antibody 50 Вµg 732 € acr human
AP51747PU-N anti-FZD2 / Frizzled-2 (C-term) Antibody 0,4 ml 587 € acr human
A03F0117 anti-FZD2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdfd2b721be Anti- FZD2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfd2bd4370 Anti- FZD2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0a60ad545 Anti- FZD2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0a611a625 Anti- FZD2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1263362f2 Anti- FZD2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be12638aa47 Anti- FZD2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be31171d8a6 Anti- FZD2 Antibody 0.2 ml 603 € MBS Polyclonals human
GENTAUR-58be49c9ecc95 Anti- FZD2 Antibody 100ug 370 € MBS Polyclonals human
abx146501 Anti-FZD2 Antibody 200 μg 369 € abbex human
abx146939 Anti-FZD2 Antibody inquire 50 € abbex human
abx147391 Anti-FZD2 Antibody 100 μg 311 € abbex human
abx902047 Anti-FZD2 siRNA inquire 50 € abbex human
abx917360 Anti-FZD2 siRNA 30 nmol 717 € abbex human
abx917361 Anti-FZD2 siRNA inquire 50 € abbex human
GWB-MN745G FZD2 antibody 1 vial 521 € genways human
LV164481 FZD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV164482 FZD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV164483 FZD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV164484 FZD2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV164486 FZD2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV164485 FZD2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
GWB-ASF219 Human FZD2 Antibody bulk Ask price € genways bulk human