Recombinant Mouse Growth Hormone Receptor, GHR, GHBP (C-Fc)

Contact us
Catalog number: CM02
Price: 783 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Mouse Growth Hormone Receptor, GHR, GHBP (C-Fc)
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 126€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are  , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules 
Molecular Weight: 3 kD, 58
UniProt number: Q3UP14
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: GHBP (C-Fc), GHR, Growth Hormone Receptor
Short name: GHBP (C-Fc), GHR, Recombinant Mouse Growth Hormone Receptor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: GHBP (C-fragment c), growth hormone receptor, recombinant Mouse Growth Hormone Receptor
Alternative technique: rec
Alternative to gene target: GHBP, GHR and IDBG-18930 and ENSG00000112964 and 2690, GHR and IDBG-629685 and ENSBTAG00000001335 and 280805, Ghr and IDBG-127871 and ENSMUSG00000055737 and 14600, nuclei, proline-rich region binding, this GO :0000187 and activation of MAPK activity and biological process this GO :0000255 and allantoin metabolic process and biological process this GO :0004903 and growth hormone receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006101 and citrate metabolic process and biological process this GO :0006103 and 2-oxoglutarate metabolic process and biological process this GO :0006105 and succinate metabolic process and biological process this GO :0006107 and oxaloacetate metabolic process and biological process this GO :0006549 and isoleucine metabolic process and biological process this GO :0006573 and valine metabolic process and biological process this GO :0006600 and creatine metabolic process and biological process this GO :0006631 and fatty acid metabolic process and biological process this GO :0006897 and endocytosis and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0009725 and response to hormone and biological process this GO :0009755 and hormone-mediated signaling pathway and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017046 and peptide hormone binding and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019530 and taurine metabolic process and biological process this GO :0019838 and growth factor binding and molecular function this GO :0019898 and extrinsic component of membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0019903 and protein phosphatase binding and molecular function this GO :0031623 and receptor internalization and biological process this GO :0032094 and response to food and biological process this GO :0032355 and response to estradiol and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0034097 and response to cytokine and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042169 and SH2 domain binding and molecular function this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0042523 and positive regulation of tyrosine phosphorylation of Stat5 protein and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042976 and activation of Janus kinase activity and biological process this GO :0042977 and activation of JAK2 kinase activity and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043235 and receptor complex and cellular component this GO :0043278 and response to morphine and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0044236 and multicellular organismal metabolic process and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0046427 and positive regulation of JAK-STAT cascade and biological process this GO :0046449 and creatinine metabolic process and biological process this GO :0046898 and response to cycloheximide and biological process this GO :0048009 and insulin-like growth factor receptor signaling pathway and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0060351 and cartilage development involved in endochondral bone morphogenesis and biological process this GO :0060396 and growth hormone receptor signaling pathway and biological process this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0070064 and proline-rich region binding and molecular function this GO :0070195 and growth hormone receptor complex and cellular component this GO :0070555 and response to interleukin-1 and biological process this GO :1901215 and negative regulation of neuron death and biological process, this GO :0004903 : growth hormone receptor activity, this GO :0004903 : growth hormone receptor activity and also this GO :0005515 : protein binding and also this GO :0017046 : peptide hormone binding and also this GO :0019838 : growth factor binding and also this GO :0019901 : protein kinase binding and also this GO :0019903 : protein phosphatase binding and also this GO :0042169 : SH2 domain binding and also this GO :0042803 : protein homodimerization activity and also this GO :0070064 : proline-rich region binding, this GO :0005515 : protein binding, this GO :0017046 : peptide hormone binding, this GO :0019838 : growth factor binding, this GO :0019901 : protein kinase binding, this GO :0019903 : protein phosphatase binding, this GO :0042169 : SH2 domain binding, this GO :0042803 : protein homodimerization activity, this GO :0070064 : proline-rich region binding, growth hormone receptor
Identity: 4263
Gene: GHR | More about : GHR
Long gene name: growth hormone receptor
Synonyms: GHBP
Synonyms name: growth hormone binding protein
Locus: 5p13, 1-p12
Discovery year: 1989-06-30
Entrez gene record: 2690
RefSeq identity: NM_000163
Classification: Fibronectin type III domain containing
Havana BLAST/BLAT: OTTHUMG00000094791
Locus Specific Databases: LOVD - Leiden Open Variation Database

Related Products :

CM02 Recombinant Mouse Growth Hormone Receptor, GHR, GHBP (C-Fc) 50 µg 232 € novo mouse
RP-1317M Recombinant Mouse Growth Hormone Receptor / GHR / GHBP Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1316M Recombinant Mouse Growth Hormone Receptor / GHR / GHBP Protein (His Tag) 50μg 659 € adv mouse
RP-2148R Recombinant Rat Growth Hormone Receptor / GHR / GHBP Protein (Fc Tag) 50μg 624 € adv rat
RP-2149R Recombinant Rat Growth Hormone Receptor / GHR / GHBP Protein (His Tag) 50μg 624 € adv rat
GHR11-A Goat Anti-Mouse Growth Hormone Receptor protein (GHR; recombinant EC-domain) 100 μL 565 € adi mouse
GHR11-C Mouse Growth Hormone Receptor (GHR; recombinant, EC-domain)-Fc protein control for WB 100 μL 333 € adi mouse
AE42213HU-48 ELISA test for Human Growth Hormone Binding Protein (GHBP) 1x plate of 48 wells 402 € abebio human
AE42213HU Human Growth Hormone Binding Protein (GHBP) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE42213HU-96 Human Growth Hormone Binding Protein (GHBP) ELISA Kit 1x plate of 96 wells 671 € abebio human
MBS614362 Parathyroid Hormone Receptor Type 2 (PTH Receptor 2, PTHR2, Parathyroid Hormone 2 Receptor, PTH2 Receptor, PTH-2 Receptor, PTH2R, Parathyroid Hormone Receptor Precursor) Antibody 100ul 652 € MBS Polyclonals_1 human
abx572994 Anti-Mouse Growth Hormone Receptor (GHR) ELISA Kit 96 tests 775 € abbex mouse
GWB-E61C85 Growth Hormone Receptor (GHR) Mouse antibody to or anti-Rat Monoclonal antibody 1 vial 648 € genways rat
DL-GHR-Mu Mouse Growth Hormone Receptor GHR ELISA Kit 96T 904 € DL elisas mouse
GENTAUR-58bde5d2472c4 Mouse Monoclonal (IgG1) to Rat Growth Hormone Receptor / GHR Antibody 50ug 597 € MBS mono rat
GENTAUR-58bdd73d2bf2c Anti- Growth Hormone Receptor (GHR) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc243e43c Anti- Growth Hormone Receptor (GHR) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddc2d3f702 Anti- Growth Hormone Receptor (GHR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bddc2d908cb Anti- Growth Hormone Receptor (GHR) Antibody 50ug 370 € MBS Polyclonals human
abx573787 Anti-Human Growth Hormone Receptor (GHR) ELISA Kit 96 tests 760 € abbex human
GENTAUR-58bb6dfccff23 Bovine Growth hormone receptor (GHR) 100ug 1724 € MBS Recombinant Proteins bovine
GENTAUR-58bb6dfd74a91 Bovine Growth hormone receptor (GHR) 1000ug 1724 € MBS Recombinant Proteins bovine
GENTAUR-58bb6dfdca2a7 Bovine Growth hormone receptor (GHR) 100ug 2232 € MBS Recombinant Proteins bovine
GENTAUR-58bb6dfe25cb6 Bovine Growth hormone receptor (GHR) 1000ug 2232 € MBS Recombinant Proteins bovine
AE60961GU-48 ELISA test for Guinea pig Growth hormone receptor (GHR) 1x plate of 48 wells 402 € abebio human
AE58671PI-48 ELISA test for Pig Growth hormone receptor (GHR) 1x plate of 48 wells 402 € abebio pig
AE42210PN-48 ELISA test for Pigeon Growth hormone receptor (GHR) 1x plate of 48 wells 402 € abebio pigeon
AE42209RB-48 ELISA test for Rabbit Growth hormone receptor (GHR) 1x plate of 48 wells 402 € abebio human
R30816 GHR Antibody Growth hormone receptor 0.1mg 389 € NJS poly human
EKU04614 Growth Hormone Receptor (GHR) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human