Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc)

Contact us
Catalog number: CK92
Price: 517 €
Supplier: ABM lentivectors
Product name: Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Ephrin A3 is produced by our Mammalian expression system and the target gene encoding Gln23-Gly206 is expressed with a Fc tag at the C-terminus
Molecular Weight: 47, 9 kD
UniProt number: O08545
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: EFNA3 (C-Fc), Ephrin-A3
Short name: EFNA3 (C-Fc), Recombinant Mouse Ephrin-A3
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: EFNA3 (C-fragment c), recombinant Mouse Ephrin-A3
Alternative technique: rec
Identity: 3223
Gene: EFNA3 | More about : EFNA3
Long gene name: ephrin A3
Synonyms gene: EPLG3
Synonyms gene name: ephrin-A3
Synonyms: LERK3 Ehk1-L
Locus: 1q21, 3
Discovery year: 1995-01-17
GenBank acession: BC017722
Entrez gene record: 1944
Pubmed identfication: 8660976
RefSeq identity: NM_004952
Classification: Ephrins
Havana BLAST/BLAT: OTTHUMG00000035313

Related Products :

CK92 Recombinant Mouse Ephrin-A3, EFNA3 (C-Fc) 500 µg 1613 € novo mouse
RP-1807H Recombinant Human Ephrin A3 / EFNA3 Protein, Fc Tag 200ug 630 € adv human
GENTAUR-58ba45d110f66 Mouse Ephrin-A3 (Efna3) 100ug 1586 € MBS Recombinant Proteins mouse
GENTAUR-58ba45d1ac8e4 Mouse Ephrin-A3 (Efna3) 1000ug 1586 € MBS Recombinant Proteins mouse
GENTAUR-58ba45d25023f Mouse Ephrin-A3 (Efna3) 100ug 2089 € MBS Recombinant Proteins mouse
GENTAUR-58ba45d2ea60c Mouse Ephrin-A3 (Efna3) 1000ug 2089 € MBS Recombinant Proteins mouse
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
abx571238 Anti-Human Ephrin A3 (EFNA3) ELISA Kit inquire 50 € abbex human
EKU03921 Ephrin A3 (EFNA3) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
DL-EFNA3-Hu Human Ephrin A3 EFNA3 ELISA Kit 96T 904 € DL elisas human
GWB-ATG222 EFNA3, 23-214aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
PR27093-5 anti-Ephrin-A1 Ephrin-A1 / EFNA1 Antibody 5 Вµg 645 € acr human
AP06387PU-N anti-Ephrin-B1 (+Ephrin-B2) Antibody 0,1 mg 558 € acr human
MBS615633 Ephrin B1 (Ephrin-B1, ELK-L, EFL-3, Cek5-L, LERK-2) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS611262 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS614848 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
A03E0028 anti-EFNA3 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdfc3da5dd1 Anti- EFNA3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc3e0cc58 Anti- EFNA3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3def17bf3 Anti- EFNA3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be465357e9f Anti- EFNA3 Antibody 100ug 393 € MBS Polyclonals human
abx145187 Anti-EFNA3 Antibody 100 μg 369 € abbex human
abx215198 Anti-EFNA3 Antibody inquire 50 € abbex human
abx915039 Anti-EFNA3 siRNA inquire 50 € abbex human
abx915040 Anti-EFNA3 siRNA inquire 50 € abbex human
MBS127856 EFNA3 Antibody 200ug 558 € MBS Polyclonals_1 human
LV145905 EFNA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human