Recombinant Mouse Exostosin-Like 2, EXTL2 (N-6His)

Contact us
Catalog number: CK88
Price: 463 €
Supplier: genways
Product name: Recombinant Mouse Exostosin-Like 2, EXTL2 (N-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Exostosin-like 2 is produced by our Mammalian expression system and the target gene encoding Asn43-Met330 is expressed with a 6His tag at the N-terminus
Molecular Weight: 33, 6 kD
UniProt number: Q9ES89
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: EXTL2 (N-6His), Exostosin-Like 2
Short name: EXTL2 (N-6His), Recombinant Mouse Exostosin-Like 2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: EXTL2 (N-6His), recombinant Mouse Exostosin-Like 2
Alternative technique: rec
Identity: 3516
Gene: EXTL2 | More about : EXTL2
Long gene name: exostosin like glycosyltransferase 2
Synonyms gene name: exostoses (multiple)-like 2
Synonyms name: alpha-1, 4-N-acteylhexosaminyltransferase
Locus: 1p21, 2
Discovery year: 1998-03-20
GenBank acession: U76189
Entrez gene record: 2135
Pubmed identfication: 9450183 15831490
RefSeq identity: NM_001439
Classification: Exostosin glycosyltransferase family
Havana BLAST/BLAT: OTTHUMG00000011814

Related Products :

CK88 Recombinant Mouse Exostosin-Like 2, EXTL2 (N-6His) 50 µg 369 € novo mouse
AP51485PU-N anti-Exostosin-like 2 (C-term) Antibody 0,4 ml 587 € acr human
AP51486PU-N anti-Exostosin-like 3 (N-term) Antibody 0,4 ml 587 € acr human
AP51487PU-N anti-Exostosin-like 3 (N-term) Antibody 0,4 ml 587 € acr human
AP51483PU-N anti-Exostosin-1 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58bdf60a39b9f Anti- EXTL2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf60a91efb Anti- EXTL2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be6420d901a Anti-EXTL2 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx915843 Anti-EXTL2 siRNA 15 nmol 528 € abbex human
abx915844 Anti-EXTL2 siRNA inquire 50 € abbex human
bs-6005R-A350 EXTL2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6005R-A488 EXTL2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6005R-A555 EXTL2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6005R-A594 EXTL2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6005R-A647 EXTL2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6005R-Biotin EXTL2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6005R EXTL2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-6005R-Cy3 EXTL2 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6005R-Cy5 EXTL2 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6005R-Cy5.5 EXTL2 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6005R-Cy7 EXTL2 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6005R-FITC EXTL2 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6005R-HRP EXTL2 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
LV151813 EXTL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV151814 EXTL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV151815 EXTL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV151816 EXTL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV151818 EXTL2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV151817 EXTL2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
GWB-BADEAD EXTL2 Over-expression Lysate reagent 1 vial 463 € genways human