Recombinant Mouse IGF Binding Protein 6, IGFBP-6 (C-6His)

Contact us
Catalog number: CK73
Price: 456 €
Supplier: adv
Product name: Recombinant Mouse IGF Binding Protein 6, IGFBP-6 (C-6His)
Quantity: 20μg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: IGF-1 acts via specific receptor, IGF-1R, IGF-II, Insulin-like growth factor -1 shares structural homology with proinsulin and is mainly produced by liver, Raf/Ras and PI3K cascades, a heterodimeric tyrosine kinase receptor that signals to various second messenger pathways such as MAPK, insulin-like growth factors -1 and -2 are important regulators of signaling that mediates growth and metabolism in cells, IGF-I
Molecular Weight: 23, 7 kD
UniProt number: P47880
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: EDTA, 2 um filtered solution of phosphate buffered saline, 4, DTT, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IGFBP-6 (C-6His), Binding Protein 6
Short name: IGFBP-6 (C-6His), Recombinant Mouse IGF Binding Protein 6
Technique: E, coli recombinant proteins are , igfs, mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: IGFBP-6 (C-6His), recombinant Mouse IGF Binding Protein 6
Alternative technique: rec

Related Products :

CK73 Recombinant Mouse IGF Binding Protein 6, IGFBP-6 (C-6His) 10 µg 156 € novo mouse
MBS616690 Insulin-Like Growth Factor Binding Protein-Like 1 (IGFBP-L1, IGFBP-rP4) Antibody 100ug 774 € MBS Polyclonals_1 human
C347 Recombinant Human Insulin-Like Growth Factor-Binding Protein 4, IGFBP-4 (C-6His) 10 µg 168 € novo human
CA41 Recombinant Human Insulin-Like Growth Factor-Binding Protein 5, IGFBP-5 (C-6His) 10 µg 202 € novo human
CM47 Recombinant Mouse Nephroblastoma Overexpressed Gene , NOV, CCN3, IGFBP-9 (C-6His) 500 µg 1328 € novo mouse
IGFBP33-C Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control 100 μL 333 € adi mouse
IGFBP53-C Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein 100 μL 333 € adi mouse
IGFBP66-R-10 Recombinant (NSO) Purified Mouse/human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control 10 μg 405 € adi mouse
IGFBP13-C Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB 100 μL 333 € adi mouse
IGFBP25-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein 10 μg 405 € adi mouse
IGFBP23-C Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB 100 μL 333 € adi mouse
IGFBP36-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein 10 μg 405 € adi mouse
IGFBP56-R-10 Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein 10 μg 405 € adi mouse
IGFBP63-C Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB 100 μL 333 € adi mouse
IGFBP73-C Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB 100 μL 333 € adi mouse
IGFBP72-C Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB 100 μL 333 € adi human
IGFBP75-R-10 Recombinant (E. coli) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control 10 μg 405 € adi e-coli
IGFBP35-R-10 Recombinant (E.Coli) purified Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein 10 μg 405 € adi human
IGFBP65-R-10 Recombinant (E.Coli) Purified human insulin-like growth factor binding protein 6 (IGFBP-6) protein WB +ve control 10 μg 405 € adi human
IGFBP55-R-10 Recombinant (E.Coli) Purified human recomb. human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control 10 μg 405 € adi human
IGFBP31-C Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control 100 μL 333 € adi human
IGFBP15-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein 10 μg 405 € adi human
IGFBP11-C Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB 100 μL 333 € adi human
IGFBP26-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein 10 μg 405 € adi human
IGFBP22-C Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB 100 μL 333 € adi human
IGFBP45-R-10 Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein 10 μg 405 € adi human
IGFBP41-C Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB 100 μL 333 € adi human
IGFBP62-C Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB 100 μL 333 € adi human
IGFBP76-R-10 Recombinant (Sf21) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control 10 μg 405 € adi human
RP-1340M Recombinant Mouse IGFBP-2 / IGFBP2 Protein (Fc Tag) 20μg 456 € adv mouse