Recombinant Mouse CD5, Leu-1 (C-6His)

Contact us
Catalog number: CK65
Price: 270 €
Supplier: adi
Product name: Recombinant Mouse CD5, Leu-1 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 9 kD
UniProt number: P13379
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Leu-1 (C-6His), CD5
Short name: Leu-1 (C-6His), Recombinant Mouse CD5
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: L-leucine-1 (C-6His), recombinant Mouse CD5 molecule
Alternative technique: rec
Alternative to gene target: CD5 and IDBG-49730 and ENSG00000110448 and 921, CD5 and IDBG-643103 and ENSBTAG00000013730 and 280745, Cd5 and IDBG-144910 and ENSMUSG00000024669 and 12507, Cell surfaces, LEU1 and T1, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005044 and scavenger receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008037 and cell recognition and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005044 : scavenger receptor activity and also this GO :0005515 : protein binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005044 : scavenger receptor activity, this GO :0005515 : protein binding, CD5 molecule
Identity: 1685
Gene: CD5 | More about : CD5
Long gene name: CD5 molecule
Synonyms gene: LEU1
Synonyms gene name: CD5 antigen (p56-62)
Synonyms: T1
Locus: 11q12, 2
Discovery year: 1986-01-01
GenBank acession: X04391
Entrez gene record: 921
Pubmed identfication: 1711157
RefSeq identity: NM_014207
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000167825

Related Products :

SP-89539-1 α-Helical CRF (9-41) [Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3826.44)] 1 mg 333 € adi human
SP-89540-1 α-Helical CRF (12-41) [Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 (MW: 3497.08)] 1 mg 333 € adi human
SP-100829-1 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) 1 mg 260 € adi human
SP-101335-1 TIP 39 (39 mer) (AA: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro)(MW: 4504.28) 1 mg 333 € adi human
SP-89720-1 [Tyr0]-Urocortin (rat) [Tyr-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; MW 4870.55] 1 mg 478 € adi human
SP-52314-1 Urocortin, Human [H-Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-THr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-Nh2; MW: 4696.3] 0,5 mg 340 € adi human
SP-89721-1 Urocortin (rat) (free acid) (AA: Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val) (MW: 4708.35) 1 mg 478 € adi human
SP-55410-1 Urocortin, Rat [H-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-THr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-THr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; MW: 477.37] 0,5 mg 340 € adi rat
SP-55406-1 Urocortrin II, Mouse [H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2; MW: 4152.98] 0,5 mg 456 € adi mouse
SP-101862-1 [Asn10,Leu11,D-Trp12]-pTH-Related Protein (7-34) amide (human, rat) [Leu-Leu-His-Asn-Leu-D-Trp-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH2; MW: 3478.11] 1 mg 260 € adi human
SP-89535-1 Biotin-CRF (human, rat) (AA: Biotin-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2) (MW: 4983.85) 1 mg 623 € adi human
SP-89205-1 Biotin-Intermedin (human) (AA: Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2) (MW: 5329.14) 1 mg 333 € adi human
SP-89207-1 Biotin-Intermedin (rat) (AA: Biotin-Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2) (MW: 5445.29) 1 mg 333 € adi human
SP-101269-1 Biotin-Secretin, human (AA: Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2) (MW: 5465.80) 1 mg 260 € adi human
SP-55238-1 C-Peptide, Dogs [H-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Gly-Gly-Ala-Leu-Gln-OH; MW: 3174.54] 0,5 mg 340 € adi human
SP-55160-1 CKS-17 [H-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu-OH; MW: 1942.31] 0,5 mg 159 € adi human
SP-55412-1 Corticotropin Releasing Factor, Bovine [H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Gly-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2; MW: 4697.44] 0,5 mg 340 € adi bovine
SP-52234-1 Corticotropin Releasing Factor, Human, Rat [H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gly-Met-Ala-Arg-Ala-Gly-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-Nh2; MW: 4575.5] 0,5 mg 340 € adi rat
SP-55413-1 Corticotropin Releasing Factor, ovine (AA: Leu-Asp-Leu-Thr-Phe-His-Leu -Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu- Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2) (MW: 4370.41) 1 mg 478 € adi human
SP-81503-1 CRF (6-33) (human, rat) (AA: Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser) (MW: 3220.73) 1 mg 260 € adi human
SP-51419-1 Enfuvirtide (T-20) [CH3CO-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2; MW: 4462] 1 mg 340 € adi human
SP-52258-1 Helodormin [His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2; MW: 3843.47] 1 mg 717 € adi human
SP-55303-1 Helospectin I [H-His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Glu-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser-Ser-OH; MW: 4095.66] 1 mg 589 € adi human
SP-55302-1 Helospectin II [H-His-Ser-Asp-Ala-THr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser-OH; MW: 4008.58] 1 mg 589 € adi human
SP-86621-1 Influenza A M2 coat protein (22 - 46) (AA: Ser-Ser-Asp-Pro-Leu-Val-Val-Ala-Ala-Ser-Ile-Ile-Gly-Ile-Leu-His-Leu-Ile-Leu-Trp-Ile-Leu-Asp-Arg-Leu) (MW: 2728.34) 1 mg 260 € adi influenza
SP-89159-1 Interleukin IL-1b (178-207) (human) (AA: Leu-Lys-Glu-Lys-Asn-Leu-Tyr-Leu-Ser-Cys-Val-Leu-Lys-Asp-Asp-Lys-Pro-Thr-Leu-Gln-Leu-Glu-Ser-Val-Asp-Pro-Lys-Asn-Tyr-Pro) (MW: 3492.07) 1 mg 260 € adi human
SP-89206-1 Intermedin (rat) (AA: Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2) (MW: 5216.99) 1 mg 405 € adi human
SP-89905-1 Mast Cell Degranulating (MCD) Peptide HR-2 (AA: Phe-Leu-Pro-Leu-Ile-Leu-Gly-Lys-Leu-Val-Lys-Gly-Leu-Leu-NH2) (MW: 1523.04) 1 mg 188 € adi human
SP-86866-1 Secretin (5 - 27), porcine (AA: Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2) (MW: 2659.11) 1 mg 260 € adi human
SP-52309-1 Secretin, Human [H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MW: 339.47] 1 mg 270 € adi human