| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
38, 9 kD |
| UniProt number: |
P13379 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
Leu-1 (C-6His), CD5 |
| Short name: |
Leu-1 (C-6His), Recombinant Mouse CD5 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
L-leucine-1 (C-6His), recombinant Mouse CD5 molecule |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD5 and IDBG-49730 and ENSG00000110448 and 921, CD5 and IDBG-643103 and ENSBTAG00000013730 and 280745, Cd5 and IDBG-144910 and ENSMUSG00000024669 and 12507, Cell surfaces, LEU1 and T1, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005044 and scavenger receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008037 and cell recognition and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005044 : scavenger receptor activity and also this GO :0005515 : protein binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005044 : scavenger receptor activity, this GO :0005515 : protein binding, CD5 molecule |
| Identity: |
1685 |
| Gene: |
CD5 |
More about : CD5 |
| Long gene name: |
CD5 molecule |
| Synonyms gene: |
LEU1 |
| Synonyms gene name: |
CD5 antigen (p56-62) |
| Synonyms: |
T1 |
| Locus: |
11q12, 2 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
X04391 |
| Entrez gene record: |
921 |
| Pubmed identfication: |
1711157 |
| RefSeq identity: |
NM_014207 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000167825 |