Recombinant Mouse Carboxylesterase 3, CES3 (C-6His)

Contact us
Catalog number: CK39
Price: 2989 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Carboxylesterase 3, CES3 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Carboxylesterase 3 is produced by our Mammalian expression system and the target gene encoding Tyr19-Glu561 is expressed with a 6His tag at the C-terminus
Molecular Weight: 4 kD, 62
UniProt number: Q8VCT4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHREVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CES3 (C-6His), Carboxylesterase 3
Short name: CES3 (C-6His), Recombinant Mouse Carboxylesterase 3
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CES3 (C-6His), recombinant Mouse Carboxylesterase 3
Alternative technique: rec
Identity: 1865
Gene: CES3 | More about : CES3
Long gene name: carboxylesterase 3
Synonyms gene name: carboxylesterase 3 (brain)
Synonyms: FLJ21736 ES31
Synonyms name: esterase 31 brain carboxylesterase BR3
Locus: 16q22, 1
Discovery year: 1999-12-14
GenBank acession: AK025389
Entrez gene record: 23491
Pubmed identfication: 10518925 14581373 15100172 20931200
RefSeq identity: NM_024922
Classification: Carboxylesterases
Havana BLAST/BLAT: OTTHUMG00000137525

Related Products :

CK39 Recombinant Mouse Carboxylesterase 3, CES3 (C-6His) 1 mg 2486 € novo mouse
MBS619274 CES1 (Carboxylesterase 1, Acyl Coenzyme A:Cholesterol Acyltransferase, ACAT, Brain Carboxylesterase hBr1, CEH, Egasyn, HMSE, HMSE1, Liver Carboxylesterase 1, MGC117365, Monocyte/macrophage Serine Esterase 1, PCE-1, Serine Esterase 1, SES1, Triacylglycerol Antibody 100ug 741 € MBS Polyclonals_1 human
RP-1612M Recombinant Mouse CES3 / Carboxylesterase-3 / CES1D Protein (His Tag) 10μg 624 € adv mouse
AE50740MO-48 ELISA test for Mouse Carboxylesterase 3 (CES3) 1x plate of 48 wells 373 € abebio mouse
AE50740MO-96 Mouse Carboxylesterase 3 (CES3) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
CK45 Recombinant Mouse Carboxylesterase 2E, CES2E (C-6His) 10 µg 202 € novo mouse
C450 Recombinant Human Carboxylesterase 1, CES1 (C-6His) 1 mg 2283 € novo human
GENTAUR-58bdef89b25e7 Anti- CES3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdef89e8cb8 Anti- CES3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3f98dbc67 Anti- CES3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be571c16f02 Anti- CES3 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be571c7312d Anti- CES3 Antibody 50ug 365 € MBS Polyclonals human
abx911570 Anti-CES3 siRNA 30 nmol 717 € abbex human
GWB-MW447F CES3 antibody 1 vial 521 € genways human
GWB-MW448G CES3 antibody 1 vial 521 € genways human
LV116971 CES3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV116972 CES3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV116973 CES3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV116974 CES3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV116976 CES3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV116975 CES3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human
RP-1181M Recombinant Mouse CES2 / Carboxylesterase-2 Protein (His Tag) 10μg 624 € adv mouse
RP-1182M Recombinant Mouse CES5 / Carboxylesterase-5 Protein (His Tag) 10μg 624 € adv mouse
RP-0402H Recombinant Human CES2 / Carboxylesterase-2 Protein (His Tag) 10μg 624 € adv human
abx255136 Anti-Mouse Carboxylesterase 5A ELISA Kit inquire 50 € abbex mouse
DL-CES1-Mu Mouse Carboxylesterase 1 CES1 ELISA Kit 96T 921 € DL elisas mouse
GENTAUR-58b8dc1daae45 Mouse Carboxylesterase 1C (Ces1c) 100ug 2475 € MBS Recombinant Proteins mouse
GENTAUR-58b8dc1e6f1cc Mouse Carboxylesterase 1C (Ces1c) 1000ug 2475 € MBS Recombinant Proteins mouse
GENTAUR-58b8dc1ed6bf4 Mouse Carboxylesterase 1C (Ces1c) 100ug 2989 € MBS Recombinant Proteins mouse
GENTAUR-58b8dc1f3691c Mouse Carboxylesterase 1C (Ces1c) 1000ug 2989 € MBS Recombinant Proteins mouse