Recombinant Mouse Interleukin-36b, IL-36b, IL1F8

Contact us
Catalog number: CK25
Price: 752 €
Supplier: genways
Product name: Recombinant Mouse Interleukin-36b, IL-36b, IL1F8
Quantity: 1 x 1 vial
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-36 beta is produced by our E, coli expression system and the target gene encoding Ser31-Lys183 is expressed
Molecular Weight: 17, 6 kD
UniProt number: Q9D6Z6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH 8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-36b, IL1F8, Interleukin-36b
Short name: IL-36b, IL1F8, Recombinant Mouse Interleukin-36b
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: IL1F8, Interleukin-36b, recombinant Mouse Interleukin-36b
Alternative technique: rec
Identity: 15564
Gene: IL36B | More about : IL36B
Long gene name: beta , interleukin 36
Synonyms gene: IL1F8
Synonyms gene name: interleukin 1 family, member 8 (eta)
Synonyms: FIL1 IL-1H2 IL-1F8 FILI-(ETA) IL1-ETA IL1H2 MGC126880 MGC126882
Locus: 2q14, 1
Discovery year: 2002-08-02
GenBank acession: AF201833
Entrez gene record: 27177
Pubmed identfication: 10625660 10512743 16646978
RefSeq identity: NM_014438
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000131338

Related Products :

CK25 Recombinant Mouse Interleukin-36b, IL-36b, IL1F8 10 µg 156 € novo mouse
AE38395HU-48 ELISA test for Human Interleukin-36 beta (IL1F8) 1x plate of 48 wells 373 € abebio human
AE38395HU Human Interleukin-36 beta (IL1F8) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE38395HU-96 Human Interleukin-36 beta (IL1F8) ELISA Kit 1x plate of 96 wells 612 € abebio human
GENTAUR-58be0c026c262 Anti- IL1F8 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c02d9b1b Anti- IL1F8 Antibody 0.12 ml 348 € MBS Polyclonals human
abx147673 Anti-IL1F8 Antibody 200 μg 369 € abbex human
AR31087PU-N anti-IL1F8 / IL1H2 Antibody 10 Вµg 369 € acr human
AR31087PU-S anti-IL1F8 / IL1H2 Antibody 2 Вµg 253 € acr human
GWB-E4642A IL1F8 Over-expression Lysate reagent 1 vial 463 € genways human
OBT0092G Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, ELISA/WB/flow 0.5 mg Ask price € accurate-monoclonals mouse
OBT0092Z Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, flow/ELISA/WB/Functional Assays: Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0092 Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; frozen, IH/ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0092R Interleukin 10 (IL-10), natural & recombinant, Clone: 2A5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0088G Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088Z Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Azide Free 1 mg Ask price € accurate-monoclonals mouse
OBT0088B Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 200ug Ask price € accurate-monoclonals mouse
OBT0088BB Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.5 mg Ask price € accurate-monoclonals mouse
OBT0088F Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1 mg Ask price € accurate-monoclonals mouse
OBT0088 Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.25 mg Ask price € accurate-monoclonals mouse
OBT0088R Interleukin 2 (IL-2), natural & recombinant, Clone: JES6.SH4.1.1, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
OBT0090 Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, Neutralizes; ELISA/WB/IA 0.5 mg Ask price € accurate-monoclonals mouse
OBT0090R Interleukin 5 (IL-5), natural & recombinant, Clone: TRFK5, Rat Mouse Monoclonal antibody-Mouse, RPE 500ul Ask price € accurate-monoclonals mouse
YM5036 Interleukin 6 (IL-6), Bioactivity inhibitor, native & recombinant, Clone: F5, Rat Mouse Monoclonal antibody-Mouse 3 ml Ask price € accurate-monoclonals mouse
YM5017 Interleukin 6 (IL-6), natural & recombinant, Clone: MP5-32C11, Mouse Monoclonal antibody-Mouse (NO X w/Human or Rat); IA/IP/Inhibition 0.1mg 1004 € accurate-monoclonals rat
MBS624348 IL6ST, phosphorylated (Tyr905) (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621212 Interleukin 1 Receptor AcP, C2 (IL1RacP, IL-1 Receptor Accessory Protein, IL-1RAP, FLJ37788, IL1R3, Interleukin 1 Accessory Protein) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS611936 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS612345 Interleukin 18BP (IL-18BP, IL18BPa, Interleukin 18 Binding Protein, Tadekinig-alfa, interferon-gamma inducing factor, IGIF) Antibody 50ug 382 € MBS Polyclonals_1 human
GWB-2163DF INTERLEUKIN 6 CROSS REACTIVE WITH RAT INTERLEUKIN 6 1 x 1 vial 752 € genways human