Recombinant Mouse Legumain, Asparaginyl Endopeptidase (C-6His)

Contact us
Catalog number: CJ83
Price: 2232 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Legumain, Asparaginyl Endopeptidase (C-6His)
Quantity: 1000ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Legumain is produced by our Mammalian expression system and the target gene encoding Val18-Tyr435 is expressed with a 6His tag at the C-terminus
Molecular Weight: 48, 7 kD
UniProt number: O89017
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHYVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Asparaginyl Endopeptidase (C-6His), Legumain
Short name: Asparaginyl Endopeptidase (C-6His), Recombinant Mouse Legumain
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Asparaginyl Endopeptidase (C-6His), recombinant Mouse Legumain
Alternative technique: rec

Related Products :

CJ83 Recombinant Mouse Legumain, Asparaginyl Endopeptidase (C-6His) 10 µg 202 € novo mouse
C371 Recombinant Human Legumain, Asparaginyl Endopeptidase (C-6His) 10 µg 202 € novo human
AE31701HU-48 ELISA test for Human Probable asparaginyl-tRNA synthetase, mitochondrial (NARS2) 1x plate of 48 wells 373 € abebio human
AE31701HU-96 Human Probable asparaginyl-tRNA synthetase, mitochondrial (NARS2) ELISA Kit 1x plate of 96 wells 612 € abebio human
RP-1390M Recombinant Mouse Legumain/ LGMN Protein (His Tag) 10μg 659 € adv mouse
MBS619226 ATG4D (ATG4 Autophagy Related 4 Homolog D, PG4D, APG4-D, AUTL4, AUT-like 4 Cysteine Endopeptidase, Autophagin-4, Autophagy-related Cysteine Endopeptidase 4, Autophagy-related Protein 4 Homolog D, Cysteine Protease ATG4D) 100ug 509 € MBS Polyclonals_1 human
abx166733 Anti-Legumain Protein (Recombinant) 100 μg 833 € abbex human
abx167282 Anti-Legumain Protein (Recombinant) 50 μg 601 € abbex human
abx154315 Anti-Mouse Legumain ELISA Kit 96 tests 949 € abbex mouse
abx571481 Anti-Mouse Legumain (LGMN) ELISA Kit inquire 50 € abbex mouse
GENTAUR-58b8784d2bf72 Mouse Legumain (Lgmn) 100ug 1890 € MBS Recombinant Proteins mouse
GENTAUR-58b8784d7ab85 Mouse Legumain (Lgmn) 1000ug 1890 € MBS Recombinant Proteins mouse
GENTAUR-58b8784dd84d8 Mouse Legumain (Lgmn) 100ug 2404 € MBS Recombinant Proteins mouse
GENTAUR-58b8784e28729 Mouse Legumain (Lgmn) 1000ug 2404 € MBS Recombinant Proteins mouse
DL-LGMN-Mu Mouse Legumain LGMN ELISA Kit 96T 921 € DL elisas mouse
abx152188 Anti-Human Legumain ELISA Kit 96 tests 934 € abbex human
abx250644 Anti-Human Legumain ELISA Kit inquire 50 € abbex human
abx572419 Anti-Human Legumain (LGMN) ELISA Kit inquire 50 € abbex human
MBS248841 Anti-Human LGMN / Legumain Antibody 200ul 597 € MBS Polyclonals_1 human
AR52022PU-N anti-Legumain (18-435, His-tag) Antibody 0,25 mg 1413 € acr human
AR52022PU-S anti-Legumain (18-435, His-tag) Antibody 50 Вµg 485 € acr human
LGMN-101AP anti-Legumain Antibody 100 µg 357 € fabgen human
abx128416 Anti-Legumain Antibody 100 μg 514 € abbex human
abx129426 Anti-Legumain Antibody 50 μg 412 € abbex human
LGMN-BIOTIN anti-Legumain Antibody BIOTIN 100 µg 456 € fabgen human
LGMN-FITC anti-Legumain Antibody FITC 100 µg 456 € fabgen human
abx257255 Anti-Legumain ELISA Kit 96 tests 557 € abbex human
GENTAUR-58be622f60233 Anti-Legumain (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58ba36a73c192 Canavalia ensiformis Legumain 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58ba36a7b3a77 Canavalia ensiformis Legumain 1000ug 2232 € MBS Recombinant Proteins human