Recombinant Mouse Resistin, ADSF, RETN (C-6His)

Contact us
Catalog number: CJ57
Price: 382 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Resistin, ADSF, RETN (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1674€ 10 µg 141€ 500 µg 1115€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Adipose tissue-specific secretory factor is produced by our Mammalian expression system and the target gene encoding Ser21-Ser114 is expressed with a 6His tag at the C-terminus
Molecular Weight: 11, 2 kD
UniProt number: Q99P87
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: ADSF, RETN (C-6His), Resistin
Short name: ADSF, RETN (C-6His), Recombinant Mouse Resistin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: ADSF, resistin (C-6His), recombinant Mouse Resistin
Alternative technique: rec
Alternative to gene target: RETN and IDBG-23228 and ENSG00000104918 and 56729, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, hormone activity, nuclei, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0007568 and aging and biological process this GO :0008150 and biological process and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010714 and positive regulation of collagen metabolic process and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0032868 and response to insulin and biological process this GO :0045444 and fat cell differentiation and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000252 and negative regulation of feeding behavior and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity, resistin
Identity: 20389
Gene: RETN | More about : RETN
Long gene name: resistin
Synonyms: FIZZ3 ADSF RETN1
Locus: 19p13, 2
Discovery year: 2003-02-03
GenBank acession: AF205952
Entrez gene record: 56729
Pubmed identfication: 12050208
RefSeq identity: NM_020415
Havana BLAST/BLAT: OTTHUMG00000182503

Related Products :

CJ57 Recombinant Mouse Resistin, ADSF, RETN (C-6His) 10 µg 141 € novo mouse
CG51 Recombinant Human Resistin, RETN, ADSF (C-6His) 10 µg 146 € novo human
RP-1717H Recombinant Human Resistin / ADSF / RETN Protein (Fc Tag) 20μg 456 € adv human
CJ48 Recombinant Human Resistin, RETN, ADSF (C-Fc) 10 µg 202 € novo human
MBS618313 Resistin-like Molecule, beta (RELMbeta, RELMb, Resistin-like beta, Resistin-like Protein beta, Resistin Like Protein beta, RETNLB, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein Precursor 2, Colon and Small Intestine-specific Cyst Antibody 100ug 597 € MBS Polyclonals_1 human
abx572202 Anti-Mouse Resistin (RETN) ELISA Kit 96 tests 572 € abbex mouse
MBS244828 Anti-Mouse RETN / Resistin Antibody 50ug 597 € MBS Polyclonals_1 mouse
GENTAUR-58bde7c32ea35 Mouse Monoclonal (IgG2b,k) to Human RETN / Resistin Antibody 500ug 597 € MBS mono human
GENTAUR-58bd5905e2f29 Mouse Resistin (Retn) 100ug 1354 € MBS Recombinant Proteins mouse
GENTAUR-58bd590638f11 Mouse Resistin (Retn) 1000ug 1354 € MBS Recombinant Proteins mouse
GENTAUR-58bd5906793b3 Mouse Resistin (Retn) 100ug 1857 € MBS Recombinant Proteins mouse
GENTAUR-58bd5906aa59f Mouse Resistin (Retn) 1000ug 1857 € MBS Recombinant Proteins mouse
DL-RETN-Mu Mouse Resistin RETN ELISA Kit 96T 672 € DL elisas mouse
abx576199 Anti-Cow Resistin (RETN) ELISA Kit 96 tests 775 € abbex cow
abx575492 Anti-Human Resistin (RETN) ELISA Kit 96 tests 673 € abbex human
abx570352 Anti-Rat Resistin (RETN) ELISA Kit inquire 50 € abbex rat
AR09496PU-N anti-Resistin / RETN Antibody 25 Вµg 384 € acr human
AR09496PU-S anti-Resistin / RETN Antibody 5 Вµg 253 € acr human
GENTAUR-58bdc426d7df3 Anti- Resistin (RETN) Antibody 100ug 343 € MBS Polyclonals human
GENTAUR-58bdc4273be4a Anti- Resistin (RETN) Antibody 50ug 288 € MBS Polyclonals human
GENTAUR-58bdc6a9c6efd Anti- Resistin (RETN) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc7c04296a Anti- Resistin (RETN) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc7c09e708 Anti- Resistin (RETN) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc9ab87040 Anti- Resistin (RETN) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcbe95de5d Anti- Resistin (RETN) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcbe9d818b Anti- Resistin (RETN) Antibody 50ug 343 € MBS Polyclonals human
GENTAUR-58bdd22ad4b45 Anti- Resistin (RETN) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd6a708cf2 Anti- Resistin (RETN) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd6fe33ac5 Anti- Resistin (RETN) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd70fc72d6 Anti- Resistin (RETN) Antibody 100ug 382 € MBS Polyclonals human