| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Adipose tissue-specific secretory factor is produced by our Mammalian expression system and the target gene encoding Ser21-Ser114 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
11, 2 kD |
| UniProt number: |
Q99P87 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
ADSF, RETN (C-6His), Resistin |
| Short name: |
ADSF, RETN (C-6His), Recombinant Mouse Resistin |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
ADSF, resistin (C-6His), recombinant Mouse Resistin |
| Alternative technique: |
rec |
| Alternative to gene target: |
RETN and IDBG-23228 and ENSG00000104918 and 56729, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, hormone activity, nuclei, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0007568 and aging and biological process this GO :0008150 and biological process and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010714 and positive regulation of collagen metabolic process and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0032868 and response to insulin and biological process this GO :0045444 and fat cell differentiation and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000252 and negative regulation of feeding behavior and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity, resistin |
| Identity: |
20389 |
| Gene: |
RETN |
More about : RETN |
| Long gene name: |
resistin |
| Synonyms: |
FIZZ3 ADSF RETN1 |
| Locus: |
19p13, 2 |
| Discovery year: |
2003-02-03 |
| GenBank acession: |
AF205952 |
| Entrez gene record: |
56729 |
| Pubmed identfication: |
12050208 |
| RefSeq identity: |
NM_020415 |
| Havana BLAST/BLAT: |
OTTHUMG00000182503 |