Recombinant Mouse Lithostathine-2, Reg2 (N-6His)

Contact us
Catalog number: CJ37
Price: 1984 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Lithostathine-2, Reg2 (N-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Islets of Langerhans regenerating protein 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ala173 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 7 kD
UniProt number: Q08731
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline pH7, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Reg2 (N-6His), Lithostathine-2
Short name: Reg2 (N-6His), Recombinant Mouse Lithostathine-2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Reg2 (N-6His), recombinant Mouse Lithostathine-2
Alternative technique: rec

Related Products :

CJ37 Recombinant Mouse Lithostathine-2, Reg2 (N-6His) 50 µg 369 € novo mouse
GENTAUR-58baf1dd33fb8 Saccharomyces cerevisiae Protein REG2 (REG2) 100ug 1967 € MBS Recombinant Proteins human
GENTAUR-58baf1dd71fe8 Saccharomyces cerevisiae Protein REG2 (REG2) 1000ug 1967 € MBS Recombinant Proteins human
GENTAUR-58baf1ddc1394 Saccharomyces cerevisiae Protein REG2 (REG2) 100ug 2481 € MBS Recombinant Proteins human
GENTAUR-58baf1de16087 Saccharomyces cerevisiae Protein REG2 (REG2) 1000ug 2481 € MBS Recombinant Proteins human
GENTAUR-58bb1e412cf92 Saccharomyces cerevisiae Protein REG2 (REG2) 100ug 1967 € MBS Recombinant Proteins human
GENTAUR-58bb1e41663e2 Saccharomyces cerevisiae Protein REG2 (REG2) 1000ug 1967 € MBS Recombinant Proteins human
GENTAUR-58bb1e41aabc3 Saccharomyces cerevisiae Protein REG2 (REG2) 100ug 2481 € MBS Recombinant Proteins human
GENTAUR-58bb1e41ee25a Saccharomyces cerevisiae Protein REG2 (REG2) 1000ug 2481 € MBS Recombinant Proteins human
RP-1611M Recombinant Mouse REG2 / REG-2 Protein (Fc Tag) 50μg 624 € adv mouse
abx258009 Anti-Mouse REG2 ELISA Kit inquire 50 € abbex mouse
abx255024 Anti-Mouse Lithostathine-1 ELISA Kit inquire 50 € abbex mouse
GENTAUR-58b8b0b07010f Mouse Lithostathine-1 (Reg1) 100ug 1481 € MBS Recombinant Proteins mouse
GENTAUR-58b8b0b0d3105 Mouse Lithostathine-1 (Reg1) 1000ug 1481 € MBS Recombinant Proteins mouse
GENTAUR-58b8b0b13005b Mouse Lithostathine-1 (Reg1) 100ug 1984 € MBS Recombinant Proteins mouse
GENTAUR-58b8b0b2ae50f Mouse Lithostathine-1 (Reg1) 1000ug 1984 € MBS Recombinant Proteins mouse
abx931232 Anti-REG2 siRNA 15 nmol 528 € abbex human
EKU08510 Regenerating Islet Derived Protein 2 (REG2) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
GENTAUR-58bd2b57f41d6 Bovine Lithostathine (PTP) 100ug 1464 € MBS Recombinant Proteins bovine
GENTAUR-58bd2b585097a Bovine Lithostathine (PTP) 1000ug 1464 € MBS Recombinant Proteins bovine
GENTAUR-58bd2b58b15fe Bovine Lithostathine (PTP) 100ug 1967 € MBS Recombinant Proteins bovine
GENTAUR-58bd2b5914331 Bovine Lithostathine (PTP) 1000ug 1967 € MBS Recombinant Proteins bovine
GENTAUR-58b8f7cb64b18 Rat Lithostathine (Reg1) 100ug 1481 € MBS Recombinant Proteins rat
GENTAUR-58b8f7cc27151 Rat Lithostathine (Reg1) 1000ug 1481 € MBS Recombinant Proteins rat
GENTAUR-58b8f7cc83552 Rat Lithostathine (Reg1) 100ug 1984 € MBS Recombinant Proteins rat
GENTAUR-58b8f7cceda00 Rat Lithostathine (Reg1) 1000ug 1984 € MBS Recombinant Proteins rat
GENTAUR-58b9f51bc03c4 Rat Lithostathine (Reg1) 100ug 1481 € MBS Recombinant Proteins rat
GENTAUR-58b9f51c22a67 Rat Lithostathine (Reg1) 1000ug 1481 € MBS Recombinant Proteins rat
GENTAUR-58b9f51c73b31 Rat Lithostathine (Reg1) 100ug 1984 € MBS Recombinant Proteins rat
GENTAUR-58b9f51ccc593 Rat Lithostathine (Reg1) 1000ug 1984 € MBS Recombinant Proteins rat