Recombinant Mouse Lithostathine-2, Reg2 (N-6His)

Catalog number:	CJ37 Buy Now
Price:	1984 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Mouse Lithostathine-2, Reg2 (N-6His)
Quantity:	1000ug
Other quantities:	1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:	mouse recombinant days lithostathine alternative reacts

More details Need more?:

Reacts with:	Mouse
Source:	proteins, Recombinants or rec
Description:	Recombinant Mouse Islets of Langerhans regenerating protein 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ala173 is expressed with a 6His tag at the N-terminus
Molecular Weight:	17, 7 kD
UniProt number:	Q08731
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	2 um filtered solution of phosphate buffered saline pH7, 4, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	HHHHHHQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Test:	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name:	Mus musculus
Group:	recombinants
Gene target:	Reg2 (N-6His), Lithostathine-2
Short name:	Reg2 (N-6His), Recombinant Mouse Lithostathine-2
Technique:	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Mouses, Mouse
Alternative name:	Reg2 (N-6His), recombinant Mouse Lithostathine-2
Alternative technique:	rec

• #mouse
• #recombinant
• #days
• #lithostathine
• #alternative
• #reacts